Recombinant Escherichia coli Putative type II secretion system protein L (gspL)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant gspL

The recombinant Escherichia coli gspL protein is a His-tagged, full-length (1–387 amino acids) construct of the putative type II secretion system (T2SS) protein L. It is expressed in E. coli and purified to >90% purity via SDS-PAGE . This protein is critical for T2SS function, enabling the secretion of folded exoproteins across the bacterial outer membrane.

Oligomerization Dynamics

  • Solution Studies:

    • Dimeric State: Dominant in solution, confirmed by SEC-MALLS .

    • Tetrameric State: Observed transiently for full-length periplasmic constructs but converts irreversibly to dimers .

  • Structural Plasticity:

    • The dimer interface lacks stabilizing hydrogen bonds/electrostatic interactions, enabling conformational flexibility .

    • Crystal structures reveal "open" and "closed" dimer conformations, suggesting dynamic interactions .

Functional Role in T2SS

gspL interacts with multiple T2SS components to facilitate secretion:

Key Interactions and Functions

Interaction PartnerRole
GspE (ATPase)Binds the cytoplasmic domain (N1E) of GspE via a conserved interface, tethering the ATPase to the inner membrane platform .
GspMForms heterodimers in the periplasm, stabilizing the inner membrane platform .
PseudopilusTransient interactions with GspG (major pseudopilin) during secretion .
GspCCollaborates with GspC in forming the inner membrane platform .

Mechanism of Action

  1. ATPase Recruitment: The cytoplasmic domain of gspL recruits GspE, enabling ATP hydrolysis to drive pseudopilus assembly .

  2. Platform Assembly: gspL, GspM, GspC, and GspF form a stoichiometric inner membrane complex (1:1:1:1 ratio) .

  3. Exoprotein Secretion: The pseudopilus acts as a piston, pushing exoproteins through the secretin channel (GspD) .

Production Protocol

  • Expression System: E. coli.

  • Purification: Ni-affinity chromatography (His tag).

  • Reconstitution: Deionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage.

Research Applications

  • Structural Studies: Crystallography and SEC-MALLS to study oligomerization .

  • Functional Assays: Co-purification with GspE/GspM to study secretion complex dynamics .

  • Biochemical Characterization: ATPase activity modulation studies (e.g., GspE ATPase activity is enhanced by acidic phospholipids and cyto-GspL) .

Research Challenges and Future Directions

  • Oligomerization Stoichiometry: Resolving the functional relevance of tetramers vs. dimers in vivo .

  • Dynamic Interactions: Elucidating how gspL’s conformational plasticity facilitates ATPase recruitment and pseudopilus assembly .

  • Therapeutic Targets: Exploring gspL as a target to disrupt pathogenic T2SS-dependent secretion (e.g., in Vibrio spp.) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gspL; yheK; b3333; JW5705; Putative type II secretion system protein L; T2SS protein L; Putative general secretion pathway protein L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
gspL
Target Protein Sequence
MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRY LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ FPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSG KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFY FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE LTQSWLPMEKTEKDPVSGVWTVRNSGK
Uniprot No.

Target Background

Function
GspL is an inner membrane component of the type II secretion system (T2SS). It is crucial for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm. GspL plays a role in the complex assembly of the T2SS, recruiting GspM to form a stable inner membrane complex. This facilitates a link between the cytoplasmic energy-providing protein GspE and the remaining T2SS machinery.
Gene References Into Functions
  1. GspL gene deletion reduces adhesion and invasion capabilities while enhancing virulence. PMID: 25958687
Database Links
Protein Families
GSP L family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Type II Secretion System and what role does GspL play in it?

The Type II Secretion System (T2SS) is a multimeric protein translocase used by Gram-negative bacteria to secrete folded proteins, including virulence factors, across the outer membrane. This system is essential in pathogens like enteropathogenic E. coli (EPEC) and other pathogenic strains for secreting toxins and degradative enzymes . The T2SS machinery consists of 12-15 different proteins that assemble into a complex spanning the bacterial envelope.

GspL (General secretion pathway protein L) is a critical inner membrane component of the T2SS that plays a crucial role in the assembly and function of the secretion apparatus. It forms part of the inner membrane platform that connects the cytoplasmic components with the periplasmic and outer membrane components of the secretion system. GspL interacts with several other T2SS components, particularly GspE (the ATPase that powers the system) and GspM (another inner membrane protein), forming a critical nexus for energy transduction within the system.

How does the T2SS mechanism differ from other bacterial secretion systems?

The T2SS has a unique two-step secretion mechanism that distinguishes it from other bacterial secretion systems. Proteins destined for secretion via the T2SS are first translocated across the cytoplasmic membrane via either the Sec or Tat machinery . Once in the periplasm, these proteins fold into their native conformation before being recognized and transported across the outer membrane by the T2SS apparatus itself.

This differs significantly from:

  • Type I secretion systems: Direct transport from cytoplasm to extracellular environment without periplasmic intermediates

  • Type III secretion systems: Needle-like structures injecting effectors directly into host cells

  • Type IV secretion systems: Can transfer both proteins and DNA directly to target cells

  • Type VI secretion systems: Contractile phage-like structures that inject effectors into both prokaryotic and eukaryotic cells

The T2SS is particularly notable for its ability to secrete fully folded proteins, which may be large and complex in structure, making it critical for the export of certain enzymes and toxins that require folding in the periplasm.

What are the optimal conditions for recombinant expression of GspL in E. coli?

For optimal recombinant expression of GspL in E. coli, a systematic optimization approach is recommended. Based on standard protocols for membrane proteins, the following conditions typically yield good results:

Expression vector selection:

  • pET-based vectors with T7 promoter for high-level expression

  • Addition of solubility tags (e.g., MBP, SUMO) to improve protein solubility

  • Inclusion of a protease-cleavable His-tag for purification purposes

Host strain selection:

  • BL21(DE3) or its derivatives for T7-based expression

  • C41(DE3) or C43(DE3) for membrane proteins that may be toxic

Culture and induction conditions:

  • Growth medium: LB broth with appropriate antibiotics (typically 100 μg/ml ampicillin)

  • Growth temperature: 37°C until reaching OD₆₀₀ of 0.5-0.7

  • Induction: IPTG concentration of 0.2 mM

  • Post-induction temperature: 18°C for 20 hours (lowering temperature improves proper folding of membrane proteins)

Harvest conditions:

  • Centrifugation at 4000 rpm at 4°C for 20 minutes

These parameters should be systematically optimized using Design of Experiments (DoE) approaches rather than one-factor-at-a-time methods to account for the complex interactions between variables .

How can Design of Experiments (DoE) be applied to optimize GspL expression?

Design of Experiments (DoE) is a powerful statistical approach for optimizing recombinant protein expression with minimal experimental runs while accounting for factor interactions . For GspL expression optimization, the following DoE approach is recommended:

Step 1: Select critical factors affecting GspL expression

  • Temperature (e.g., 18°C, 25°C, 30°C, 37°C)

  • IPTG concentration (e.g., 0.1 mM, 0.5 mM, 1.0 mM)

  • Induction time (e.g., early log, mid-log, late log phase)

  • Media composition (e.g., LB, TB, 2YT)

  • Host strain (e.g., BL21(DE3), C41(DE3), Rosetta)

Step 2: Choose appropriate DoE methodology
For initial screening, a fractional factorial design can identify significant factors with reduced experimental runs. For detailed optimization, response surface methodology (RSM) can be applied.

Step 3: Experimental design example
A central composite design for three factors might include:

RunTemperature (°C)IPTG (mM)Induction OD₆₀₀GspL Yield (mg/L)
1180.10.5Data point 1
2181.00.9Data point 2
3300.10.9Data point 3
4301.00.5Data point 4
5240.550.7Data point 5
...............

Step 4: Data analysis
Analysis of variance (ANOVA) should be performed to identify significant factors and interactions. Software packages can help generate response surface plots to visualize optimal conditions .

This approach is significantly more efficient than the traditional one-factor-at-a-time optimization, as it accounts for interaction effects between variables that might be missed in conventional approaches.

What are the most effective methods for purifying recombinant GspL?

Purifying recombinant GspL presents challenges due to its nature as a membrane protein. The following methodology has been proven effective:

Membrane protein extraction:

  • Resuspend cell pellet in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, protease inhibitors)

  • Disrupt cells via sonication or high-pressure homogenization

  • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

  • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Solubilize membranes using appropriate detergents (e.g., n-dodecyl-β-D-maltopyranoside (DDM) at 1% w/v, or LDAO)

Affinity purification:

  • Apply solubilized membrane fraction to Ni-NTA or TALON resin if His-tagged

  • Wash extensively with buffer containing low imidazole (20-30 mM) and reduced detergent (0.05-0.1%)

  • Elute with buffer containing high imidazole (250-300 mM)

Additional purification steps:

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

  • Ion exchange chromatography if additional purity is required

Detergent exchange or reconstitution:
For functional studies, consider detergent exchange to a milder detergent or reconstitution into nanodiscs, liposomes, or amphipols to maintain protein stability and function.

The choice between keeping solubility tags or removing them depends on downstream applications. If structural or functional studies are planned, tag removal using specific proteases (e.g., TEV, PreScission) is recommended, followed by a reverse affinity step to remove the cleaved tag.

How can one assess the proper folding and functionality of purified recombinant GspL?

Assessing proper folding and functionality of recombinant GspL requires multiple complementary approaches:

Biophysical characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Fluorescence spectroscopy to evaluate tertiary structure (if GspL contains tryptophan residues)

  • Thermal shift assays to determine protein stability and identify stabilizing conditions

  • Dynamic light scattering (DLS) to verify monodispersity and absence of aggregation

Functional assays:

  • In vitro protein-protein interaction assays with known binding partners:

    • Pull-down assays with other T2SS components, particularly GspE and GspM

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to determine binding affinities

    • Crosslinking assays to capture transient interactions

  • ATPase activity assays (indirect measure):

    • Since GspL interacts with the ATPase GspE, measure the effect of GspL on GspE's ATPase activity

    • Monitoring phosphate release using malachite green or coupled enzyme assays

  • Complementation of gspL deletion strains:

    • Restore the function of T2SS in a ΔgspL strain by expressing the recombinant protein

    • Monitor secretion of known T2SS substrates like SslE (heat-labile enterotoxin reporter can be used)

  • Membrane insertion verification:

    • Liposome flotation assays to verify proper membrane association

    • Protease protection assays to verify correct topology

A properly folded and functional GspL should demonstrate the expected secondary structure composition, interact specifically with known binding partners, and complement the phenotypic defects observed in gspL deletion strains.

How should experiments be designed to study GspL's role in biofilm formation?

To study GspL's role in biofilm formation, a systematic experimental design approach is recommended. The evidence from search results indicates that functional T2SS is essential for biofilm formation by EPEC, with T2SS mutants being arrested at the microcolony stage . To investigate GspL's specific contribution, consider this experimental framework:

1. Genetic approach:

  • Create isogenic mutant strains:

    • ΔgspL knockout mutant

    • Complemented strain (ΔgspL + plasmid-encoded GspL)

    • Site-directed mutants targeting specific GspL domains

    • GspL-tagged version (if visualization is needed)

2. Biofilm formation assays:

  • Static biofilm assay in 96-well plates

  • Flow cell biofilm systems for real-time observation

  • Quantification methods:

    • Crystal violet staining for biomass

    • Confocal microscopy for architecture analysis

    • Viable cell counts for living bacteria within biofilm

3. Experimental design structure:
Following the principles of randomized block design (RBD) , organize experiments to eliminate variation due to external factors:

  • Block by experimental batch

  • Include all strains in each experimental run

  • Randomize position of samples within microplate

  • Use multiple technical and biological replicates

4. Data collection timeline:
Measure biofilm formation at multiple time points (e.g., 6h, 12h, 24h, 48h, 72h) to track the kinetics of biofilm development and identify at which stage GspL exerts its influence.

5. Analysis of variance (ANOVA):
Employ statistical analysis to determine significant differences between wild-type, mutant, and complemented strains .

StrainBiofilm Biomass (OD₅₉₅)6h24h48h72h
WTMean ± SDDataDataDataData
ΔgspLMean ± SDDataDataDataData
Comp.Mean ± SDDataDataDataData

6. Microscopic analysis:
Perform confocal microscopy to examine biofilm architecture, particularly focusing on the transition from microcolonies to mature biofilms, which appears to be T2SS-dependent .

This experimental design accounts for variability, includes appropriate controls, and allows for statistical analysis of GspL's specific contribution to biofilm formation processes.

What experimental design is optimal for studying protein-protein interactions involving GspL in the T2SS?

Studying protein-protein interactions of GspL within the T2SS requires a multi-faceted approach. The following experimental design combines in vivo and in vitro methods to comprehensively characterize GspL interactions:

1. In vivo approaches:

  • Bacterial two-hybrid system:

    • Create fusion constructs of GspL and potential interacting partners

    • Test pairwise interactions in a matrix format

    • Quantify interaction strength through reporter gene expression

  • Co-immunoprecipitation from native conditions:

    • Express epitope-tagged GspL in E. coli

    • Crosslink protein complexes in vivo (optional step)

    • Immunoprecipitate GspL and identify co-precipitating partners via western blot or mass spectrometry

  • FRET or BRET analysis:

    • Create fluorescent protein fusions to GspL and potential partners

    • Measure energy transfer as indication of protein proximity

    • Perform in living bacteria to preserve native environment

2. In vitro approaches:

  • Pull-down assays:

    • Immobilize purified GspL on affinity resin

    • Incubate with cell lysate or purified potential partners

    • Analyze bound proteins by SDS-PAGE and western blotting or mass spectrometry

  • Surface plasmon resonance (SPR):

    • Immobilize GspL or binding partners on sensor chip

    • Measure binding kinetics and affinity constants

    • Test effects of mutations on binding parameters

  • Isothermal titration calorimetry (ITC):

    • Directly measure thermodynamic parameters of interactions

    • Determine stoichiometry, affinity, and thermodynamic signature

3. Crosslinking mass spectrometry:

  • Use chemical crosslinkers to capture transient interactions

  • Digest crosslinked complexes and analyze by mass spectrometry

  • Map interaction interfaces at amino acid resolution

4. Experimental design structure:
Using the cube design approach , systematically vary experimental conditions to identify optimal interaction parameters:

Variables to test in factorial design
pH values (6.0, 6.5, 7.0, 7.5, 8.0)
Salt concentration (50-300 mM NaCl)
Detergent types and concentrations
Presence of nucleotides (ATP, ADP)

5. Data analysis:
For quantitative interaction data, use statistical analysis to determine significance of interactions and effects of experimental variables .

This comprehensive experimental design allows for both identification of GspL interaction partners and detailed characterization of these interactions, providing insights into the assembly and function of the T2SS machinery.

How can structural biology approaches be applied to study GspL?

Structural biology approaches provide crucial insights into GspL's function and interactions within the T2SS. The following methodologies are particularly valuable for GspL structural studies:

X-ray crystallography approach:

  • Produce highly pure, homogeneous GspL protein or relevant domains

  • Screen extensively for crystallization conditions

  • For membrane-spanning regions, consider:

    • Using soluble domains only

    • Generating fusion proteins with crystallization chaperones

    • Employing lipidic cubic phase crystallization for full-length protein

  • Collect diffraction data and solve phase problem (potentially using selenomethionine derivatives)

Cryo-electron microscopy (Cryo-EM):

  • Particularly valuable for membrane proteins and large complexes

  • Sample preparation approaches:

    • Detergent-solubilized GspL

    • GspL reconstituted in nanodiscs or amphipols

    • GspL in complex with interaction partners

  • Single-particle analysis workflow for isolated complexes

  • Sub-tomogram averaging for in situ structural studies

NMR spectroscopy:

  • Suitable for studying dynamics and smaller domains of GspL

  • Isotopic labeling requirements (¹⁵N, ¹³C, ²H)

  • Particularly useful for:

    • Mapping interaction interfaces

    • Studying conformational changes upon binding

    • Characterizing disordered regions

Integrative structural biology:
Combine multiple techniques for comprehensive structural characterization:

Expression and purification considerations:
When preparing GspL for structural studies, consider:

  • Construct design to maximize stability and homogeneity

  • Detergent screening for membrane regions

  • Incorporation of deuteration for NMR and neutron scattering

  • Co-expression with binding partners for complex stability

These structural biology approaches, especially when used in combination, can provide unprecedented insights into GspL's structure-function relationships within the T2SS machinery.

What are the current challenges and contradictions in the functional understanding of GspL?

Current research on GspL faces several challenges and contradictions that merit further investigation:

Structural topology contradictions:
Different models have been proposed for the membrane topology of GspL, with variations in the number of transmembrane helices and orientation of domains. These contradictions may arise from:

  • Species-specific differences in GspL structure

  • Experimental artifacts in topology mapping

  • Potential dynamic changes in topology during secretion

Functional ambiguity:
The precise role of GspL in the secretion mechanism remains debated:

  • Some evidence suggests GspL functions primarily as a structural scaffold

  • Other studies indicate a more active role in energy transduction from the GspE ATPase

  • Contradictory results exist regarding whether GspL's periplasmic domain directly interacts with secreted substrates

Interaction network inconsistencies:
Different studies report varying interaction partners and strengths:

  • Some report strong GspL-GspM interactions as central

  • Others emphasize GspL-GspE interactions

  • The stoichiometry of these interactions remains uncertain

Species-specific differences:
Significant variations exist between GspL proteins from different bacterial species:

  • Differences in domain organization

  • Varying phenotypic effects of gspL mutations

  • Species-specific interaction partners

Research challenges:
Several technical challenges complicate GspL research:

  • Difficulty in expressing and purifying full-length GspL while maintaining native conformation

  • Challenge of reconstituting functional T2SS complexes in vitro

  • Limited structural information on the assembled T2SS machinery

  • Difficulty in directly observing the secretion process in real-time

Methodological approaches to address contradictions:

  • Combine complementary structural techniques (X-ray, Cryo-EM, NMR)

  • Perform comparative studies across multiple bacterial species

  • Develop improved in vitro reconstitution systems

  • Apply single-molecule techniques to observe dynamic processes

  • Use genetic suppressor screens to identify functional relationships

These challenges represent important opportunities for researchers to make significant contributions to the understanding of GspL function in type II secretion systems.

What are the recommended protocols for site-directed mutagenesis of GspL to study structure-function relationships?

Site-directed mutagenesis of GspL is a powerful approach for investigating structure-function relationships. The following comprehensive protocol details the process from design to validation:

Step 1: Strategic mutation design

  • Target conserved residues identified through sequence alignment

  • Focus on predicted functional domains:

    • Cytoplasmic domain (interacts with GspE)

    • Transmembrane regions (crucial for membrane anchoring)

    • Periplasmic domain (interacts with GspM and other components)

  • Create three types of mutations:

    • Alanine substitutions to remove side chain functionality

    • Conservative substitutions to test chemical requirements

    • Radical substitutions to dramatically alter properties

Step 2: Primer design for QuikChange PCR

  • Design primers 25-45 nucleotides in length

  • Position mutation in the middle of the primer

  • Ensure ~40% GC content and Tm ≥78°C

  • Terminate with G or C bases

  • Verify primers don't form secondary structures

Step 3: PCR mutagenesis procedure

  • Reaction setup (50 μL):

    • 5-50 ng template plasmid

    • 125 ng of each primer

    • 200 μM dNTPs

    • 1× reaction buffer

    • 2.5 U high-fidelity DNA polymerase

  • Cycling conditions:

    • Initial denaturation: 95°C, 2 min

    • 18 cycles: 95°C for 30 sec, 55°C for 1 min, 68°C for 1 min/kb of plasmid

    • Final extension: 68°C, 10 min

  • DpnI digestion:

    • Add 1 μL DpnI (10 U)

    • Incubate at 37°C for 1 hour to digest methylated template DNA

Step 4: Transformation and screening

  • Transform 2-5 μL reaction into competent E. coli cells

  • Plate on selective media

  • Screen 3-5 colonies by sequencing

Step 5: Functional validation of mutants
Employ multiple assays to assess the effect of mutations:

Assay TypePurposeMethod
Expression analysisVerify stable protein expressionWestern blot
LocalizationConfirm proper membrane insertionFractionation + western blot
Protein-protein interactionsTest interactions with partnersBacterial two-hybrid or pull-down
Secretion activityAssess T2SS functionalityMonitor secretion of SslE
Biofilm formationTest physiological outcomeCrystal violet assay

Step 6: Data analysis

  • Compare mutant phenotypes to wild-type in all assays

  • For quantitative assays, use statistical analysis to determine significance

  • Create structure-function maps correlating mutation positions with phenotypic effects

This comprehensive approach allows systematic exploration of GspL domains and specific residues critical for different aspects of T2SS function.

What methods are most effective for monitoring the in vivo dynamics of GspL during T2SS assembly and function?

Monitoring the in vivo dynamics of GspL during T2SS assembly and function requires advanced imaging and biochemical techniques. The following methodological approaches provide complementary insights:

1. Fluorescent protein fusion approaches:

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Create functional GspL-fluorescent protein fusions

    • Photobleach a region of interest in living bacteria

    • Monitor fluorescence recovery to determine mobility

    • Calculate diffusion coefficients and mobile/immobile fractions

  • Single-molecule tracking:

    • Use photoactivatable fluorescent proteins (e.g., PAmCherry)

    • Activate small subsets of molecules

    • Track individual molecules to map movement patterns

    • Determine residence times at different cellular locations

  • FRET-based interaction monitoring:

    • Create donor-acceptor pairs of T2SS components

    • Monitor FRET efficiency changes during secretion process

    • Detect conformational changes through changes in FRET signal

2. Biochemical approaches for temporal dynamics:

  • Pulse-chase analysis:

    • Pulse-label GspL with isotopic amino acids

    • Chase with non-labeled amino acids

    • Track maturation and complex formation over time

    • Determine half-life and assembly kinetics

  • Crosslinking time-course:

    • Apply membrane-permeable crosslinkers at different time points

    • Analyze crosslinked products to detect changing interaction patterns

    • Identify temporal sequence of complex assembly

  • Secretion synchronization:

    • Develop methods to temporarily arrest and release secretion

    • Monitor GspL localization and interactions during restart

    • Identify rate-limiting steps in assembly process

3. Advanced imaging techniques:

  • Super-resolution microscopy:

    • PALM/STORM imaging to visualize T2SS clusters at ~20 nm resolution

    • Structured illumination microscopy for live-cell dynamics

    • Quantify stoichiometry and spatial organization

  • Correlative light and electron microscopy:

    • Combine fluorescence imaging with electron microscopy

    • Localize GspL in the context of cellular ultrastructure

    • Visualize T2SS machinery architecture in situ

4. Experimental design considerations:

  • Inducible expression systems:

    • Titratable promoters to control expression levels

    • Temperature-sensitive alleles for conditional studies

    • Degron tags for rapid protein depletion

  • Synchronized cultures:

    • Cell-cycle synchronization methods

    • Secretion-competent vs. non-competent conditions

    • Environmental triggers for T2SS activation

These methodologies should be combined in a comprehensive experimental design that tracks GspL dynamics across multiple timescales, from rapid conformational changes (milliseconds-seconds) to assembly processes (minutes) and system maturation (hours).

How can the T2SS and GspL be engineered for biotechnological applications in protein secretion?

The T2SS offers significant potential for biotechnological applications due to its ability to secrete fully folded proteins across the outer membrane of Gram-negative bacteria. Engineering GspL and other T2SS components can enhance this system for various applications:

Protein secretion platform development:

  • Optimizing the T2SS secretion signal:

    • Identify minimal secretion signals from natural T2SS substrates like SslE

    • Create chimeric signal sequences for efficient recognition

    • Develop algorithms to predict secretability of target proteins

  • GspL engineering for enhanced secretion:

    • Modify the cytoplasmic domain to optimize interaction with GspE

    • Engineer the periplasmic domain for broader substrate recognition

    • Create GspL variants with increased stability and expression

  • Modular T2SS components:

    • Develop standardized genetic parts for T2SS components

    • Create libraries of GspL variants with different properties

    • Design orthogonal T2SS systems for simultaneous secretion of different proteins

Experimental approach for optimization:
A response surface methodology (RSM) design is ideal for optimizing the T2SS secretion system, allowing systematic exploration of:

  • Expression levels of individual components

  • Ratio between different T2SS proteins

  • Culture conditions affecting secretion efficiency

FactorLevel -1Level 0Level +1
GspL expression levelLowMediumHigh
Growth temperature25°C30°C37°C
Inducer concentration0.1 mM0.5 mM1.0 mM

Potential biotechnological applications:

  • Protein production platform:

    • Secretion of recombinant proteins directly to culture medium

    • Simplified downstream processing (no cell lysis required)

    • Production of proteins that require periplasmic folding

  • Whole-cell biocatalysis:

    • Surface display of enzymes via modified T2SS

    • Creation of enzyme cascades with spatial organization

    • Development of self-regenerating biocatalysts

  • Vaccine development:

    • Secretion of antigenic proteins for easier purification

    • Live bacterial vaccine vectors secreting antigens

    • Outer membrane vesicle (OMV) production with T2SS antigens

  • Biosensor development:

    • Engineered bacteria secreting reporter proteins in response to stimuli

    • T2SS-based signal amplification systems

    • Environmental monitoring applications

The optimization of these systems should employ Design of Experiments (DoE) approaches to efficiently explore the parameter space and identify optimal conditions for each application .

How does GspL structure and function compare across different bacterial species?

GspL proteins across bacterial species show interesting patterns of conservation and divergence that provide insights into their core functions and species-specific adaptations:

Sequence and structure conservation:

Comparative analysis of GspL proteins across species reveals:

  • A highly conserved cytoplasmic domain that interacts with the ATPase GspE

  • Variable transmembrane regions that reflect differences in membrane composition

  • More divergent periplasmic domains that may interact with species-specific partners

The conservation pattern suggests that the energy coupling function (via GspE interaction) represents the core ancestral role, while periplasmic interactions have evolved to accommodate species-specific secretion needs.

Functional comparison across pathogenic species:

SpeciesGspL Distinctive FeaturesT2SS SubstratesPathogenicity Relevance
E. coli (EPEC)Essential for biofilm formationSslE lipoproteinIntestinal colonization
V. choleraeExtended periplasmic domainCholera toxinPrimary virulence factor
P. aeruginosaMultiple paralogsElastase, lipasesTissue damage in infections
Klebsiella speciesHighly conserved with E. coliPullulanaseCapsule formation

Experimental evidence for functional conservation:

Cross-complementation experiments have shown that:

  • GspL proteins from closely related species can partially complement each other's function

  • The cytoplasmic domain shows highest functional conservation

  • Species-specific differences become apparent in interaction studies with other T2SS components

Evolutionary insights:

Phylogenetic analysis of GspL sequences reveals:

  • Vertical inheritance as the predominant evolutionary pattern

  • Evidence of horizontal gene transfer in some pathogenic lineages

  • Co-evolution with other T2SS components, particularly GspE and GspM

  • Adaptive evolution in the periplasmic domain correlating with substrate diversity

Structural biology perspective:

Available structural data indicates:

  • Conservation of key interfacial residues for protein-protein interactions

  • Divergence in surface-exposed loops

  • Maintenance of critical structural elements despite sequence variation

This comparative analysis provides a framework for understanding the core functions of GspL that are essential across species, versus the adaptable elements that have evolved for species-specific secretion requirements. This knowledge can guide experimental design when studying GspL in different bacterial systems.

What are the common challenges in recombinant GspL expression and how can they be overcome?

Recombinant expression of GspL presents several challenges due to its nature as a membrane protein with multiple domains. Here are the most common issues and effective solutions:

Challenge 1: Low expression levels

Problem: GspL expression often results in low yields due to toxicity or degradation.

Solutions:

  • Use tightly controlled induction systems (e.g., pBAD vectors with titratable arabinose)

  • Lower growth temperature to 18°C after induction

  • Try specialized host strains designed for membrane proteins (C41/C43)

  • Add stabilizing agents to growth media (glycerol, specific ions)

  • Use fusion partners known to enhance membrane protein expression (MBP, SUMO)

Challenge 2: Protein aggregation and inclusion body formation

Problem: GspL tends to aggregate when overexpressed.

Solutions:

  • Reduce expression rate by lowering inducer concentration (0.1-0.2 mM IPTG)

  • Express at lower temperatures (18-25°C) for extended periods

  • Add chemical chaperones to growth media (glycerol, arginine, trehalose)

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

  • Consider refolding protocols if inclusion bodies are unavoidable

Challenge 3: Poor membrane integration

Problem: Improper folding leading to mislocalization or degradation.

Solutions:

  • Optimize Shine-Dalgarno sequence and distance to start codon

  • Ensure proper signal sequence if using secretion tags

  • Use specialized membrane protein expression vectors

  • Try different detergents for extraction (DDM, LDAO, Fos-choline)

  • Consider nanodiscs or amphipols for stabilization

Challenge 4: Proteolytic degradation

Problem: GspL is susceptible to proteolysis during expression or purification.

Solutions:

  • Use protease-deficient strains (BL21, HB2151)

  • Add protease inhibitors throughout purification

  • Optimize buffer conditions (pH, salt concentration)

  • Keep samples cold (4°C) throughout processing

  • Consider adding stabilizing ligands if known

Challenge 5: Poor solubility during purification

Problem: GspL may precipitate during purification steps.

Solutions:

  • Screen detergent type and concentration systematically

  • Include glycerol (10-20%) in purification buffers

  • Maintain detergent above critical micelle concentration

  • Add lipids to stabilize the protein

  • Consider on-column detergent exchange

Challenge 6: Inactive protein

Problem: Purified GspL lacks functional activity.

Solutions:

  • Co-express with interaction partners (GspE, GspM)

  • Verify proper folding using biophysical techniques

  • Test different buffer conditions for activity assays

  • Consider lipid composition for reconstitution

  • Validate protein integrity by limited proteolysis

A systematic Design of Experiments (DoE) approach is recommended to efficiently optimize expression and purification conditions rather than changing one variable at a time .

How can researchers troubleshoot inconsistent results in GspL functional assays?

When encountering inconsistent results in GspL functional assays, a systematic troubleshooting approach is essential. Below is a comprehensive guide to identifying and resolving common sources of variability:

Experimental design and statistical considerations:

  • Inadequate replication:

    • Ensure sufficient biological replicates (minimum 3, preferably 5-6)

    • Include technical replicates within each biological replicate

    • Use randomized block design to control for batch effects

  • Statistical power issues:

    • Perform power analysis to determine adequate sample size

    • Use appropriate statistical tests based on data distribution

    • Consider non-parametric tests if assumptions of normality are violated

  • Lack of appropriate controls:

    • Always include positive and negative controls

    • Use wild-type, empty vector, and inactive mutant controls

    • Consider including a standard reference sample across experiments

Technical factors affecting reproducibility:

VariablePotential IssueTroubleshooting Approach
Expression levelsInconsistent GspL expressionQuantify protein levels by western blot in each experiment
Protein stabilityDegradation during experimentAdd protease inhibitors, check integrity by western blot
EnvironmentTemperature fluctuationsUse temperature-controlled incubators, monitor conditions
Media compositionBatch-to-batch variationPrepare media in bulk, use defined media when possible
Growth phaseVariation in culture ODStandardize harvest points by OD rather than time

Assay-specific troubleshooting:

  • Protein-protein interaction assays:

    • Verify expression of both partner proteins

    • Test interaction in multiple systems (bacterial two-hybrid, pull-down)

    • Control for non-specific interactions

    • Standardize lysis and binding conditions

  • Secretion activity assays:

    • Use multiple substrate reporters to validate results

    • Standardize culture conditions and sample processing

    • Quantify secreted proteins relative to cellular content

    • Check for cell lysis that might contaminate secreted fraction

  • Biofilm formation assays:

    • Standardize surface materials and treatments

    • Control humidity and evaporation

    • Use multiple quantification methods (CV staining, CFU counts)

    • Consider flow cell systems for more controlled conditions

Systematic approach to resolution:

  • Variation mapping:

    • Identify which step introduces the most variation

    • Design experiments specifically to test individual variables

    • Use Latin Square Design when testing multiple factors

  • Protocol standardization:

    • Document detailed protocols with all parameters

    • Implement standard operating procedures (SOPs)

    • Use automation where possible to reduce human error

  • Cross-validation:

    • Verify key findings using independent methods

    • Have different researchers replicate critical experiments

    • Consider collaborative validation with other laboratories

By implementing these systematic troubleshooting approaches, researchers can identify sources of inconsistency in GspL functional assays and develop robust, reproducible experimental protocols.

What are the emerging research questions about GspL that remain to be addressed?

Despite significant advances in understanding GspL and the T2SS, several important research questions remain unresolved, presenting opportunities for future investigation:

Structural dynamics during secretion:

  • How does GspL change conformation during the secretion cycle?

  • What is the mechanism of energy transfer from GspE ATPase activity to mechanical work?

  • Are there intermediate states of GspL during secretion that could be targeted for inhibition?

Regulatory mechanisms:

  • How is GspL expression regulated in response to environmental conditions?

  • Are there post-translational modifications of GspL that affect its function?

  • What signals trigger assembly/disassembly of the T2SS machinery?

Species-specific adaptations:

  • Why do some pathogens maintain multiple T2SS gene clusters with distinct GspL proteins?

  • How have GspL proteins evolved to accommodate different substrates?

  • What determines substrate specificity differences between species?

Systems-level understanding:

  • How does the T2SS interact with other secretion systems and cellular processes?

  • What is the stoichiometry of GspL in the assembled T2SS complex?

  • How is T2SS assembly coordinated with the production of secreted substrates?

Therapeutic targeting:

  • Can GspL-specific inhibitors block T2SS function without affecting host processes?

  • Are there conserved interaction interfaces that could be targeted across pathogens?

  • Could structural knowledge of GspL enable development of novel antimicrobials?

Biotechnological applications:

  • Can GspL be engineered to recognize and secrete non-native proteins efficiently?

  • How might GspL be modified to create orthogonal secretion systems?

  • Could synthetic biology approaches create novel T2SS with enhanced properties?

Methodological advances needed:

  • Development of in vitro reconstitution systems for the complete T2SS

  • Real-time assays to monitor secretion at the single-cell level

  • Improved structural methods to capture the dynamic T2SS machinery

These research questions represent important frontiers in understanding GspL function and leveraging this knowledge for therapeutic and biotechnological applications.

How can systems biology approaches advance our understanding of GspL in the context of the complete T2SS?

Systems biology approaches offer powerful frameworks for understanding GspL within the complex T2SS machinery and its broader cellular context. The following integrated approaches can significantly advance our understanding:

Multi-omics integration:

  • Genomics:

    • Comparative genomic analysis across bacterial species

    • Identification of conserved genetic contexts and operonic structures

    • Detection of regulatory elements controlling gspL expression

  • Transcriptomics:

    • RNA-Seq to determine co-expression patterns with other T2SS components

    • Transcriptional responses to environmental conditions

    • Identification of small RNAs regulating gspL expression

  • Proteomics:

    • Quantitative proteomics to measure stoichiometry of T2SS components

    • Protein-protein interaction networks via AP-MS or BioID

    • Post-translational modifications affecting GspL function

  • Metabolomics:

    • Metabolic changes associated with T2SS activation

    • Impact of carbon source on T2SS function

    • Energetic requirements for T2SS operation

Network modeling approaches:

  • Protein interaction networks:

    • Constructing comprehensive T2SS interactomes

    • Identifying hub proteins and critical interactions

    • Mapping interaction dynamics during secretion process

  • Regulatory networks:

    • Modeling transcriptional regulation of T2SS components

    • Identifying feedback loops in T2SS regulation

    • Predicting system responses to environmental perturbations

  • Flux-balance analysis:

    • Modeling metabolic costs of T2SS operation

    • Predicting optimal conditions for secretion

    • Integration with whole-cell metabolic models

Experimental design for systems approaches:

A comprehensive experimental design would include:

ApproachExperimental MethodExpected Outcome
Temporal dynamicsTime-course sampling after secretion triggerDynamic changes in T2SS complex assembly
Perturbation analysisgspL mutations / controlled expressionSystem-wide effects of GspL perturbation
Environmental variationMatrix of conditions (pH, temperature, nutrients)Environmental regulation of T2SS
Multi-strain comparisonParallel analysis of diverse E. coli strainsCore vs. variable aspects of T2SS function

Data integration and modeling:

  • Mathematical modeling:

    • Kinetic models of T2SS assembly and function

    • Stochastic models of secretion events

    • Structural models incorporating protein dynamics

  • Machine learning approaches:

    • Prediction of substrate recognition determinants

    • Feature extraction from T2SS sequence/structure data

    • Classification of functional vs. non-functional T2SS variants

  • Visualization tools:

    • Interactive maps of T2SS component interactions

    • Temporal visualization of secretion process

    • Multi-scale modeling from molecular to cellular levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.