Recombinant Escherichia coli Putrescine transport system permease protein PotH (potH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this requirement in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing your specified tag.
Synonyms
potH; b0856; JW0840; Putrescine transport system permease protein PotH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
potH
Target Protein Sequence
MSTLEPAAQSKPPGGFKLWLSQLQMKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMA RAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPL AWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTI LHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGG IIAGSMLVFIPAVGEFVIPELLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIV PIMWFHKHQQKSVGEHG
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex PotFGHI involved in putrescine uptake. It plays a crucial role in translocating the substrate across the membrane. The protein imports putrescine to maintain the optimal concentration of polyamines required for cell growth in the presence of glucose.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the putrescine transport system in E. coli and what role does PotH play within it?

The putrescine transport system in E. coli is a specialized periplasmic transport system responsible for the uptake of putrescine, a biologically important polyamine. This system consists of four essential proteins encoded by the potFGHI operon. Within this system, PotH (M₍r₎ = 35,000) functions as one of the two integral membrane components that forms the transmembrane channel for putrescine passage .

The complete system includes:

  • PotF: The periplasmic putrescine-specific binding protein (M₍r₎ = 38,000)

  • PotG: An ATP-binding protein with nucleotide-binding domains (M₍r₎ = 45,000)

  • PotH: A transmembrane protein with six membrane-spanning segments (M₍r₎ = 35,000)

  • PotI: A second transmembrane protein with six membrane-spanning segments (M₍r₎ = 31,000)

PotH works in conjunction with PotI to form the membrane channel through which putrescine is transported, while PotG provides the energy for transport through ATP hydrolysis . All four proteins must be expressed together for maximal putrescine transport activity .

How is the potH gene organized within the putrescine transport operon?

The potH gene is located within the potFGHI operon that maps at the 19-minute position on the E. coli chromosome. This operon contains four open reading frames encoding the PotF, PotG, PotH, and PotI proteins, respectively. Transcriptional analysis has revealed that transcription of this operon initiates from a T residue located either 149 or 150 nucleotides upstream from the initiator AUG codon of the potF gene .

The organization is as follows:

  • The operon is transcribed as a single polycistronic mRNA

  • The potH gene is positioned third in the operon, following potF and potG

  • Transcription is regulated by specific promoter elements upstream of potF

  • The genes are arranged in the order corresponding to their functional sequence in the transport process

Experimental evidence from subcloning studies and mutational analysis indicates that expression of all four proteins is necessary for maximal putrescine transport activity .

What are the structural characteristics of the PotH protein?

PotH is a hydrophobic membrane protein with the following structural characteristics:

  • Molecular weight of approximately 35,000 Da

  • Consists of six putative transmembrane-spanning segments

  • These transmembrane segments are linked by hydrophilic segments of variable length

  • The protein's structure is characterized by a distinct hydropathy profile

  • Functions in conjunction with PotI to form the transmembrane channel for putrescine transport

PotH shows approximately 37% sequence homology with PotB, its counterpart in the spermidine-putrescine transport system (potABCD) . This level of homology suggests evolutionary relationship between these two polyamine transport systems while maintaining distinct substrate preferences.

How does the expression of recombinant PotH impact bacterial growth and metabolism?

Expression of recombinant PotH, like other recombinant proteins, places a significant metabolic burden on E. coli host cells. This burden manifests in several ways:

  • Transcriptional and translational machinery impacts: Recombinant protein production significantly alters both transcriptional and translational machinery, affecting the metabolic burden, growth rate, and productivity of the culture .

  • Growth rate effects: Cells expressing recombinant PotH typically show reduced growth rates compared to non-recombinant counterparts due to resource allocation toward heterologous protein production .

  • Strain-dependent effects: Different E. coli strains (e.g., M15 vs. DH5α) show significant differences in their capacity to handle the metabolic burden of recombinant protein expression, with some strains demonstrating superior expression characteristics .

  • Timing effects: The timing of induction for protein synthesis plays a critical role in determining the fate of the recombinant protein within the host cell, ultimately affecting protein yield and product quality .

What expression systems are most effective for recombinant PotH production in E. coli?

The pET expression system is widely regarded as one of the most effective platforms for recombinant protein production in E. coli, including membrane proteins like PotH. Key features of this system include:

  • Vector design: The pET series of plasmids contain the strong φ10 promoter for T7 RNA polymerase and the Tφ transcription terminator, supporting high levels of transcription in E. coli strains containing the DE3 lysogen .

  • Expression control: These vectors contain a lac operator sequence adjacent to the T7 promoter that suppresses uninduced expression, providing tight control over protein production .

  • Translation elements: Translation is typically mediated by a Shine-Dalgarno sequence derived from the major capsid protein of T7 (gene 10 protein) .

  • Modern improvements: Recent modifications to pET vectors have addressed design flaws in the original genetic modules, resulting in significant increases in protein production .

For membrane proteins like PotH, additional considerations include:

  • Using specialized E. coli strains designed for membrane protein expression

  • Optimizing growth temperature (often lowered to 18-25°C)

  • Careful selection of induction timing and inducer concentration

  • Inclusion of molecular chaperones to aid proper folding

What methods can be used to assess the functionality of recombinant PotH protein?

Several methodologies can be employed to evaluate whether recombinant PotH is properly folded and functional:

  • Putrescine transport assays:

    • Measure the uptake of radiolabeled putrescine (e.g., [¹⁴C]putrescine) in cells expressing wild-type or mutant PotH

    • Typical assay conditions: 10 mM Tris-HCl (pH 7.5), 30 mM KCl, with 4 μM [¹⁴C]putrescine

    • Incubation at 30°C for 5 minutes

    • Collection of cells on membrane filters and measurement of radioactivity by liquid scintillation spectrometry

  • Complementation studies:

    • Transform potH knockout strains with plasmids expressing wild-type or mutant PotH

    • Assess restoration of putrescine transport function

    • Compare growth characteristics in media where putrescine transport is advantageous

  • Resistance/susceptibility testing:

    • Evaluate resistance to antimicrobial compounds that require PotH for entry

    • For example, testing susceptibility to antimicrobial peptides like lacritin peptide 'N-104'

  • Subcellular localization verification:

    • Confirm proper membrane localization using cell fractionation techniques

    • Western blotting of membrane fractions using PotH-specific antibodies

    • Fluorescent fusion proteins to visualize membrane localization

How can site-directed mutagenesis be applied to study PotH function?

Site-directed mutagenesis is a powerful approach for investigating the structure-function relationships of PotH. A systematic workflow includes:

  • Target selection:

    • Identify conserved residues through sequence alignment with homologous proteins

    • Focus on residues in predicted transmembrane segments or at domain interfaces

    • Select residues implicated in putrescine binding or channel formation

  • Mutagenesis protocol:

    • Use PCR-based methods to introduce specific mutations in the potH gene

    • Clone mutated genes into appropriate expression vectors

    • Verify mutations by DNA sequencing

  • Functional assessment:

    • Express mutant proteins in a potH-deficient background

    • Measure putrescine transport activity using radiolabeled substrates

    • Compare transport kinetics (Km and Vmax) between wild-type and mutant proteins

  • Structural validation:

    • Confirm proper folding and membrane insertion of mutant proteins

    • Assess protein stability through thermal or chemical denaturation studies

    • Evaluate oligomerization status if applicable

For example, a study on a related putrescine transporter created 26 site-directed mutants to test a homology model, revealing the importance of specific aromatic residues in the putrescine binding pocket .

How does PotH function within the broader context of polyamine transport systems in E. coli?

E. coli possesses two distinct polyamine transport systems with different substrate preferences:

  • PotABCD system:

    • Primarily involved in spermidine transport

    • Also transports putrescine but with lower affinity

    • PotA is the ATP-binding protein

    • PotB and PotC form the transmembrane channel

    • PotD is the periplasmic binding protein with higher affinity for spermidine

  • PotFGHI system:

    • Specialized for putrescine transport

    • PotG is the ATP-binding protein

    • PotH and PotI form the transmembrane channel

    • PotF is the periplasmic binding protein specific for putrescine

These systems share significant homology: PotF and PotD (35%), PotG and PotA (42%), PotH and PotB (37%), and PotI and PotC (36%) . Despite these similarities, they maintain distinct substrate preferences, with the PotFGHI system showing specificity for putrescine over spermidine.

Research has demonstrated that these systems can partially complement each other but maintain different kinetic properties and regulatory controls, allowing E. coli to fine-tune polyamine uptake based on environmental conditions and cellular needs .

What strategies can optimize recombinant PotH expression in E. coli?

Several advanced strategies can enhance recombinant PotH expression:

  • N-terminal sequence optimization:
    Recent research has demonstrated that modifying the N-terminal coding sequences can significantly increase protein production yield. Using a directed evolution-based methodology with fluorescent activated cell sorting (FACS), researchers have achieved up to 30-fold increases in soluble recombinant protein production .

  • Expression vector improvements:
    Modern redesigns of pET expression plasmids have addressed design flaws in the original genetic modules, resulting in increased protein production. These improvements are applicable to most vectors in the pET series and can be easily implemented .

  • Induction timing optimization:
    The timing of protein synthesis induction plays a critical role in determining protein yield. Studies have shown that induction at different growth phases significantly impacts recombinant protein production and metabolic burden .

  • Host strain selection:
    Different E. coli strains exhibit significant differences in protein expression capabilities. For example, the M15 strain has demonstrated superior expression characteristics for certain recombinant proteins compared to DH5α strain, particularly in relation to fatty acid and lipid biosynthesis pathways .

  • Proteomics-guided optimization:
    Using proteomics to investigate the dynamics of parent and recombinant cells can identify specific cellular pathways affected by recombinant protein production, guiding rational strain engineering for optimized production .

What is the relationship between PotH and antimicrobial susceptibility?

The PotH protein plays a significant and previously underappreciated role in antimicrobial susceptibility:

  • Antimicrobial peptide entry:
    Research has identified PotH as essential for the bactericidal activity of certain antimicrobial peptides. For example, the lacritin peptide 'N-104', which has antimicrobial properties, requires PotH for its activity against E. coli. When potH is knocked out, bacteria become resistant to this peptide .

  • Screening methodology:
    A comprehensive screen of the Keio E. coli K-12 single-gene knockout collection identified potH as one of five genes whose deletion conferred resistance to the antimicrobial peptide N-104. This finding suggests PotH may serve as an entry point or facilitator for certain antimicrobial compounds .

  • Mechanism validation:
    Complementation experiments where the mutant potH strain was transfected with a potH plasmid restored susceptibility to the antimicrobial peptide, confirming the specific role of PotH in this process .

  • Putrescine involvement:
    Experiments examining the effect of exogenous putrescine on antimicrobial efficacy suggest that the natural substrate of PotH may compete with or influence the interaction with antimicrobial compounds .

This relationship between polyamine transporters and antimicrobial susceptibility opens new avenues for antimicrobial drug development and understanding resistance mechanisms.

How have homology models contributed to understanding PotH structure and function?

While no crystal structure of PotH is currently available, homology modeling has provided valuable insights:

  • Template selection:
    Related transporters with solved crystal structures, such as the AdiC arginine-agmatine antiporter, have served as templates for modeling polyamine transporters .

  • Structural predictions:
    Homology models typically predict that PotH consists of 12 transmembrane helices organized in two V-shaped antiparallel domains with discontinuities in the helical structures of certain transmembrane spans .

  • Functional elements identification:
    Models have suggested specific residues that may participate in gating systems (e.g., salt bridges between acidic and basic residues) and substrate binding pockets (often involving aromatic and polar residues) .

  • Experimental validation:
    The validity of homology models can be tested through site-directed mutagenesis of predicted key residues, followed by functional transport assays and localization studies. This approach has been successfully applied to related putrescine transporters, supporting the robustness of such models .

For instance, in a study of a putrescine-cadaverine permease (related to PotH), a homology model predicted that residues Trp 241 and a Glu 247-Arg 403 salt bridge participate in a gating system, while residues Asn 245, Tyr 148, and Tyr 400 contribute to the putrescine binding pocket. When 26 site-directed mutants were created and tested, the results supported these predictions .

How do mutations in PotH affect putrescine transport and cellular physiology?

Mutations in PotH can have diverse effects on putrescine transport and broader cellular functions:

  • Transport kinetics alterations:
    Mutations in key residues can affect the binding affinity (Km) or transport rate (Vmax) for putrescine. For example, mutations in transmembrane domains may alter the channel dimensions or electrostatic properties .

  • Substrate specificity changes:
    Certain mutations can expand or restrict the range of substrates transported, potentially affecting the distinction between putrescine and other polyamines like spermidine .

  • Antimicrobial susceptibility:
    As demonstrated with lacritin peptide 'N-104', knockout of potH confers resistance to certain antimicrobial compounds, suggesting that mutations could affect bacterial susceptibility to antimicrobials .

  • Metabolic impacts:
    Since polyamines play crucial roles in various cellular processes, including DNA stabilization, protein synthesis, and cell growth, disruption of putrescine transport through PotH mutations can have broad metabolic consequences .

  • Stress response alterations:
    In some organisms, mutations in polyamine transporters exacerbate bacterial virulence and stress responses, suggesting that PotH mutations might similarly affect E. coli's ability to adapt to environmental challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.