Recombinant Escherichia coli Regulator of sigma E protease (rseP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (incurring additional fees).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
rseP; ecfE; yaeL; b0176; JW0171; Regulator of sigma-E protease RseP; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
rseP
Target Protein Sequence
MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYV IALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVF IIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTI TVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIG FVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG PISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVS ERVQDFCYRIGSILLVLLMGLALFNDFSRL
Uniprot No.

Target Background

Function

Recombinant Escherichia coli Regulator of sigma E protease (RseP) is a site-2 regulated intramembrane protease (S2P) that cleaves the peptide bond between Ala-108 and Cys-109 within the transmembrane region of RseA. It's a component of the regulated intramembrane proteolysis (RIP) cascade, acting on DegS-cleaved RseA to release the cytoplasmic domain (potentially requiring RseA residue Val-148). This process facilitates sigma-E (RpoE) activity via RseA proteolysis. RseP also cleaves transmembrane sequences in other proteins (e.g., LacY) and liberated signal peptides (e.g., beta-lactamase, OmpF, LivK, SecM, PhoA, LivJ, OmpC, Lpp, and TorA), likely within the membrane.

Gene References Into Functions
  1. This publication details several methods for characterizing the proteolytic functions and structure of RseP, primarily in vivo. These methods include proteolytic activity assays using model substrates, in vitro analysis of signal peptide cleavage in detergent solutions and membrane vesicles, structural analysis of membrane-embedded RseP (based on cysteine residue thiol modifiability), and protein interaction studies. PMID: 28065260
  2. Mutations affecting the potential beta-strand conformation of the loop impaired RseP proteolytic activity, with some mutations causing differential substrate cleavage. PMID: 26447507
  3. This study indicates that recognition of the cleaved amino acid by the RseP PDZ domain isn't essential for sequential RseA cleavage and the sigma(E) stress response in vivo. PMID: 23016873
  4. E. coli RseP (an S2P family I-CLiP) cleaves signal peptides following signal peptidase-mediated liberation from preproteins. PMID: 21810987
  5. RseP (required for normal sigmaE activation) prevents toxicity caused by two specific outer membrane proteins down-regulated by RseX. PMID: 16513633
  6. RseP catalyzes the proteolytic cleavage of membrane-bound anti-sigma(E) protein RseA, a crucial step in transmembrane signal transduction within the sigma(E) extracytoplasmic stress response pathway. PMID: 18268014
  7. Circularly permutated PDZ domains regulate RseP, the S2P family intramembrane protease in E. coli. PMID: 18945679
  8. Following DegS cleavage, the newly exposed carboxyl terminus of RseA may facilitate Site-2 cleavage via direct interaction with the PDZ domain. PMID: 19706448
Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RseP and what is its role in Escherichia coli?

RseP, formerly known as YaeL, is an Escherichia coli regulated intramembrane proteolysis (RIP) protease that functions within the bacterial cell membrane. Its primary known role is introducing the second cleavage into anti-σE protein RseA at a position within or close to the transmembrane segment. This proteolytic activity is crucial for the σE stress response cascade in E. coli, which helps the bacterium respond to extracytoplasmic stress. The cleavage of RseA by RseP leads to the release and activation of σE, allowing it to direct RNA polymerase to transcribe genes essential for responding to envelope stress .

How does RseP differ from other bacterial proteases?

RseP belongs to the S2P (site-2 protease) family of intramembrane proteases, which is distinct from other bacterial proteases in several ways:

  • Location and mechanism: Unlike many proteases that function in the cytoplasm or periplasm, RseP cleaves substrates within the membrane bilayer itself.

  • Substrate specificity: RseP can cleave transmembrane sequences of membrane proteins when they contain residues with low helical propensity, suggesting a unique substrate recognition mechanism .

  • Structural features: RseP contains two tandemly arranged periplasmic PDZ domains that function as a size-exclusion filter to prevent access of substrates with large periplasmic regions to the membrane-embedded protease domain .

  • Sequential proteolysis requirement: RseP typically acts after an initial cleavage by another protease in the periplasmic domain of its substrate, making it part of a regulated proteolytic cascade rather than acting alone .

How should I design experiments to study RseP's proteolytic activity?

When designing experiments to study RseP's proteolytic activity, consider the following methodological approach:

  • In vivo and in vitro systems: Establish both cellular (in vivo) and purified component (in vitro) systems to verify that observed effects are directly attributable to RseP. This dual approach allows you to control for cellular complexity while confirming direct enzymatic activity .

  • Substrate selection: Include both native substrates (e.g., RseA) and model substrates with varying transmembrane properties to assess substrate specificity. Design transmembrane sequences with varying helical propensities to test structural requirements .

  • Control conditions: Include inactive RseP mutants (typically with mutations in the HEXXH metalloprotease motif) as negative controls .

  • Detection methods: Implement Western blotting with antibodies specific to the substrate or use reporter fusion proteins (e.g., alkaline phosphatase fusions) to detect cleavage products .

  • Quantification approach: Apply appropriate statistical analyses, ensuring consistent precision in your data measurements with the same number of decimal places in all experimental values .

  • Experimental variables: Systematically manipulate factors like temperature, pH, and membrane composition to determine optimal conditions for RseP activity .

What research methods are most effective for studying RseP-substrate interactions?

To effectively study RseP-substrate interactions, researchers should consider implementing these methodological approaches:

  • Structure-based mutational analysis: Introduce systematic mutations in both RseP and substrates to identify critical residues for interaction and catalysis .

  • Cross-linking experiments: Utilize chemical cross-linking to capture transient enzyme-substrate complexes, providing insights into binding interfaces .

  • Reconstitution in proteoliposomes: Reconstitute purified RseP and substrates into artificial membrane systems to study direct interactions under controlled conditions .

  • Computational modeling: Use molecular dynamics simulations to predict substrate binding and unwinding mechanisms, followed by experimental validation .

  • Fluorescence-based assays: Implement FRET (Förster Resonance Energy Transfer) or fluorogenic substrate assays for real-time monitoring of proteolytic activity .

For rigorous experimental design, apply Design of Experiments (DoE) approaches rather than the less efficient one-factor-at-a-time method. This allows for understanding combined effects of multiple factors through a carefully selected set of experiments .

How does the gating mechanism of RseP regulate substrate entry?

The gating mechanism of RseP regulates substrate entry through a sophisticated process involving multiple domains:

  • Conformational changes: Structure-based chemical modification and cross-linking experiments indicate that the RseP domains surrounding the active center undergo conformational changes to expose the substrate-binding site. This suggests RseP employs a gating mechanism to regulate substrate entry rather than maintaining constant accessibility .

  • Electrostatic linkage: A conserved electrostatic linkage between transmembrane and peripheral membrane-associated domains mediates these conformational changes. Mutations disrupting this linkage alter RseP's ability to accommodate substrates .

  • PDZ domains function: The two tandemly arranged periplasmic PDZ domains act as a size-exclusion filter, preventing access of substrates with large periplasmic regions to the membrane-embedded protease domain. This mechanism ensures that only properly processed substrates (those that have undergone prior periplasmic cleavage) can access the active site .

  • Dynamic gate operation: Structural and biochemical studies propose that the peripheral and intramembrane domains of RseP undergo dynamic conformational changes, acting as a gate that modulates the entry of the transmembrane segment of periplasmically processed substrates into the hydrophilic active site compartment formed in the membrane .

What role does RseP play in membrane protein quality control beyond the σE pathway?

Beyond its established role in the σE pathway, RseP likely contributes to membrane protein quality control through several mechanisms:

  • Degradation of abnormal membrane proteins: RseP may work in concert with other membrane proteases like FtsH and HtpX in eliminating abnormal membrane proteins. Evidence includes the observation that simultaneous disruption of ftsH and rseP causes a synthetic growth defect, suggesting complementary roles in membrane protein quality control .

  • Processing of TM-containing fragments: Degradation of membrane proteins by other proteases may generate transmembrane fragments, and RseP could have a role in their elimination, functioning as a secondary processor in a multi-protease quality control system .

  • Signal peptide processing: The finding that RseP can cleave β-lactamase signal peptide raises the possibility that it acts as a signal peptide peptidase (SPP) in E. coli, an organism lacking a canonical SPP ortholog. This suggests a potential role in clearing signal peptides that remain in the membrane after secretory protein translocation .

  • Broader substrate range: Research indicates that RseP can cleave transmembrane sequences of model membrane proteins unrelated to RseA, provided the transmembrane region contains residues of low helical propensity. This broad substrate potential suggests RseP may recognize and process various membrane proteins with specific structural characteristics rather than sequence-specific motifs .

How should researchers structure data collection and analysis for RseP activity studies?

When structuring data collection and analysis for RseP activity studies, researchers should implement the following methodological framework:

Data Collection Structure:

  • Design comprehensive data tables with appropriate columns for:

    • Independent variables (e.g., substrate concentrations, time points)

    • Raw data for the responding variables with multiple trials

    • Processed data (averages and standard deviations)

  • Ensure consistent precision in data recording:

    • Use the same number of decimal places (significant digits) across measurements

    • Include appropriate units and measurement uncertainty for all raw data

Analysis Framework:

  • Apply appropriate statistical methods to determine:

    • Enzyme kinetic parameters (Km, Vmax, kcat)

    • Substrate specificity profiles

    • Effects of experimental conditions on activity

  • Implement comparative analyses:

    • Between wild-type and mutant RseP variants

    • Across different substrate types

    • Between in vivo and in vitro systems

  • Consider advanced analytical approaches:

    • Structure-function correlation analysis

    • Systems biology modeling of RseP's role in stress response networks

    • Proteomics-based substrate identification approaches

Table 1: Example Data Structure for RseP Activity Assay

Substrate concentration (μM)Trial 1 activity (μmol/min)Trial 2 activity (μmol/min)Trial 3 activity (μmol/min)Mean activity (μmol/min)Standard deviation
0.50.0230.0260.0210.0230.003
1.00.0450.0420.0470.0450.003
2.00.0820.0860.0790.0820.004

What bioinformatic approaches help identify potential RseP substrates?

Identifying potential RseP substrates requires sophisticated bioinformatic approaches that integrate multiple data types and analytical strategies:

  • Transmembrane domain prediction algorithms:

    • Use specialized tools like TMHMM, Phobius, or TOPCONS to identify proteins with transmembrane domains

    • Focus on proteins with transmembrane regions containing helix-destabilizing residues (Gly, Pro, polar residues)

  • Structural motif analysis:

    • Search for membrane proteins with transmembrane segments containing residues with low helical propensity

    • Identify proteins with structural features similar to known substrates (RseA, FecR)

  • Integration with experimental proteomics:

    • Analyze proteomic data from RseP-deficient strains compared to wild-type

    • Look for membrane proteins or fragments that accumulate in the absence of RseP

  • Evolutionary conservation analysis:

    • Identify proteins with conserved transmembrane domains across bacterial species that possess RseP homologs

    • Analyze co-evolution patterns between RseP and potential substrates

  • Machine learning approaches:

    • Train models on known RseP substrates and their features

    • Apply predictive algorithms to identify novel candidates with similar characteristics

  • Network analysis:

    • Integrate with protein-protein interaction data

    • Identify proteins functionally connected to known RseP substrates or pathways

How can researchers overcome the challenges of working with membrane proteins like RseP?

Working with membrane proteins like RseP presents several technical challenges that researchers can address using the following methodological approaches:

  • Protein expression optimization:

    • Use specialized expression systems designed for membrane proteins (e.g., C41/C43 E. coli strains)

    • Implement controlled expression strategies using tunable promoters to prevent toxicity

    • Consider fusion tags that enhance membrane protein folding and stability

  • Purification strategies:

    • Select appropriate detergents through systematic screening (e.g., DDM, LMNG, GDN)

    • Consider alternative solubilization approaches using styrene-maleic acid lipid particles (SMALPs) or nanodiscs to maintain native lipid environment

    • Implement quality control checkpoints using techniques like size-exclusion chromatography and dynamic light scattering

  • Activity assay development:

    • Design fluorogenic or chromogenic substrates that allow continuous monitoring

    • Establish liposome-reconstituted activity assays to mimic native membrane environment

    • Implement high-sensitivity detection methods for cleaved products

  • Structural analysis adaptations:

    • Utilize specialized crystallization techniques for membrane proteins

    • Consider cryo-electron microscopy as an alternative to crystallography

    • Apply hydrogen-deuterium exchange mass spectrometry to study conformational dynamics

  • In vivo analysis approaches:

    • Design genetic systems to bypass lethality of RseP deletion

    • Utilize inducible expression systems for controlled studies

    • Implement substrate trapping mutants to capture transient interactions

What are the key considerations for developing in vitro RseP activity assays?

Developing effective in vitro activity assays for RseP requires careful consideration of multiple factors:

  • Purification system selection:

    • Choose expression hosts and purification protocols that maintain RseP in its native conformation

    • Verify protein quality through multiple biophysical techniques (e.g., circular dichroism, thermostability assays)

  • Membrane environment reconstruction:

    • Select appropriate lipid compositions to mimic E. coli inner membrane

    • Consider reconstitution into proteoliposomes or nanodiscs rather than detergent micelles

    • Systematically test the impact of lipid composition on activity

  • Substrate design considerations:

    • Develop model substrates with optimal properties for detection and quantification

    • Include both natural substrates (RseA fragments) and engineered substrates

    • Design substrates with fluorescent reporter groups positioned for optimal signal change upon cleavage

  • Assay conditions optimization:

    • Systematically test buffer conditions (pH, ionic strength, divalent cations)

    • Optimize temperature and incubation times

    • Implement appropriate controls including inactive RseP variants

  • Data analysis framework:

    • Establish appropriate kinetic models for data interpretation

    • Implement statistical approaches to quantify enzymatic parameters

    • Validate in vitro findings with complementary in vivo approaches

  • Quality control procedures:

    • Implement rigorous experimental controls for each assay component

    • Establish acceptance criteria for assay performance

    • Ensure reproducibility through multiple independent preparations

How does RseP research contribute to our understanding of bacterial stress responses?

RseP research provides critical insights into bacterial stress response mechanisms through several key contributions:

  • Regulatory network architecture: Studies of RseP elucidate the complex regulatory architecture of the σE pathway, demonstrating how sequential proteolysis can create sophisticated signal transduction mechanisms that respond to specific stress conditions .

  • Membrane stress sensing mechanisms: RseP's role in the σE pathway illustrates how bacteria detect and respond to membrane and protein folding stresses through a proteolytic cascade, providing a model for understanding similar systems in other bacteria .

  • Stress response integration: Research shows how RseP-mediated proteolysis connects to broader cellular processes, integrating membrane protein quality control with transcriptional responses to maintain envelope homeostasis .

  • Evolutionary conservation: Comparative studies of RseP homologs across bacterial species reveal evolutionarily conserved stress response mechanisms, highlighting fundamental principles of bacterial adaptation to environmental challenges .

  • Regulatory precision: The gating mechanism of RseP demonstrates how bacteria achieve precise control over stress responses, preventing inappropriate activation while ensuring rapid response when needed .

What methodological advances from RseP studies can be applied to other intramembrane proteases?

RseP research has pioneered several methodological advances that can be applied to studies of other intramembrane proteases:

  • Combined in vivo/in vitro approaches: The parallel use of cellular systems and purified components established for RseP provides a powerful framework for studying other intramembrane proteases, allowing researchers to connect physiological relevance with direct biochemical properties .

  • Substrate unwinding mechanisms: Studies showing how RseP's membrane-reentrant β-sheet structure binds and extends substrate transmembrane segments for proteolysis reveal a mechanism potentially common to other intramembrane proteases, providing a conceptual framework for similar investigations .

  • Conformational gating models: The discovery that RseP undergoes conformational changes to regulate substrate access provides a model for investigating regulatory mechanisms in other intramembrane proteases, highlighting the importance of dynamic structural changes in enzyme function .

  • Reconstitution systems: Technical approaches developed for reconstituting RseP in membrane mimetics can be adapted for other challenging membrane enzymes, offering practical solutions to common technical obstacles .

  • Structure-function analysis frameworks: The systematic mutational approach used to correlate RseP structure with function demonstrates how to dissect complex membrane enzyme mechanisms, providing a blueprint for similar studies of other systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.