Recombinant Escherichia coli Respiratory nitrate reductase 1 gamma chain (narI)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Nitrate Respiration

NarI is indispensable for enzyme assembly and activity:

  • Electron Transfer: Mediates electron flow from the quinone pool to the molybdenum active site in NarG .

  • Membrane Localization: Ensures proper orientation of the catalytic subunits (NarG/NarH) within the membrane .

  • Genetic Regulation: Co-expressed with narG, narH, and narJ under anaerobic conditions regulated by Fnr and nitrate induction .

Recombinant Production and Purification

The recombinant protein is typically expressed in E. coli and purified using affinity chromatography:

  • Expression: Induced under anaerobic conditions with nitrate .

  • Purification: His-tag affinity chromatography yields >90% purity (confirmed by SDS-PAGE) .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

Research Applications

Recombinant NarI is widely used in biochemical and structural studies:

  • Enzyme Assembly Studies: Co-expression with NarG and NarH restores nitrate reductase activity in narI mutants .

  • Respiratory Complex Analysis: Co-purifies with cytochrome bc1 and aa3 supercomplexes in membrane fractionation studies .

  • Structural Biology: Serves as a model for understanding transmembrane electron transport mechanisms .

Key Research Findings

  • Gene Necessity: Deletion of narI disrupts membrane localization of nitrate reductase, leaving activity confined to the cytoplasm .

  • Interactions with NarJ: The chaperone protein NarJ is required for proper folding of NarI and integration into the membrane .

  • Electron Pathway: Mutagenesis studies confirm that heme ligands in NarI are essential for quinone binding and proton translocation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
narI; chlI; b1227; JW1218; Respiratory nitrate reductase 1 gamma chain; Cytochrome B-NR; Nitrate reductase A subunit gamma; Quinol-nitrate oxidoreductase subunit gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
narI
Target Protein Sequence
MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGIL GIFVGHFFGMLTPHWMYEAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRA TTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGV AFIFRLHLVLGMTLFLLFPFSRLIHIWSVPVEYLTRKYQLVRARH
Uniprot No.

Target Background

Function
The nitrate reductase enzyme complex enables E. coli to utilize nitrate as an electron acceptor during anaerobic growth. The gamma chain is a membrane-embedded heme-iron unit resembling cytochrome b, responsible for transferring electrons from quinones to the beta subunit.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NarI in the E. coli respiratory nitrate reductase complex?

NarI functions as the gamma subunit of the respiratory nitrate reductase complex in E. coli, serving as an integral membrane protein that anchors the enzyme complex to the cytoplasmic membrane. It contains b-type heme groups and plays a critical role in electron transfer from the quinol pool to the catalytic subunits. Structurally, NarI spans the cytoplasmic membrane and forms part of the electron transfer pathway that ultimately enables the reduction of nitrate to nitrite during anaerobic respiration.

How does NarI interact with other subunits of the nitrate reductase complex?

NarI interacts primarily with the NarH (beta) subunit of the nitrate reductase complex, forming a membrane-associated structure that connects to the catalytic NarG (alpha) subunit. This interaction occurs through specific protein-protein contacts that ensure proper electron flow from the quinol pool through NarI's heme groups to the iron-sulfur clusters in NarH and ultimately to the molybdenum cofactor in NarG where nitrate reduction occurs.

To study these interactions, researchers employ several techniques:

  • Co-immunoprecipitation assays using antibodies against specific subunits

  • Bacterial two-hybrid systems to detect protein-protein interactions

  • Cross-linking experiments followed by mass spectrometry to identify interaction sites

  • Site-directed mutagenesis of putative interaction domains followed by activity assays

The stoichiometry of the complex is typically 1:1:1 (NarG:NarH:NarI), with the possibility of a fourth subunit (NarJ) that serves as an assembly factor but is not present in the mature complex.

What transcriptional factors regulate narI expression in E. coli?

The expression of narI, as part of the narGHJI operon, is primarily regulated by multiple transcription factors that respond to oxygen limitation and the presence of nitrate or nitrite:

  • FNR (Fumarate and Nitrate Reduction) - A primary regulator that senses oxygen depletion through its iron-sulfur cluster and activates narGHJI transcription under anaerobic conditions .

  • NarL and NarP - Two-component system response regulators that are phosphorylated by their sensor kinases (NarX and NarQ) in response to nitrate or nitrite, enhancing narGHJI expression .

  • NsrR - A nitric oxide-sensitive transcriptional repressor that regulates genes involved in nitrosative stress responses. While NsrR primarily regulates genes like hmpA, ytfE, and hcp-hcr, it may indirectly influence narI expression through its regulatory network .

To experimentally investigate these regulatory mechanisms, researchers typically use:

  • Promoter-reporter fusion constructs (e.g., narG promoter-lacZ)

  • Gel shift assays to demonstrate direct binding of transcription factors to promoter regions

  • ChIP-seq to identify genomic binding sites in vivo

  • qRT-PCR to quantify transcriptional changes under different conditions

How do post-transcriptional mechanisms affect NarI synthesis and integration?

Post-transcriptional regulation of narI involves several mechanisms that affect mRNA stability, translation efficiency, and protein integration into the membrane:

  • sRNA Regulation: Small RNAs like RyhB may indirectly influence narI expression by targeting regulatory proteins. In E. coli, the sRNAs SdsN and DicF have been shown to repress expression of the narP and narL response regulators, respectively, which would consequently affect narGHJI expression .

  • mRNA Stability: The narGHJI transcript stability is influenced by growth conditions, with increased stability under anaerobic conditions with nitrate present.

  • Membrane Integration: As an integral membrane protein, NarI requires the SecYEG translocon and YidC insertase for proper membrane integration. This process is coordinated with the synthesis of other subunits to ensure proper complex assembly.

  • Heme Incorporation: The assembly of functional NarI depends on proper incorporation of b-type hemes, which requires specific machinery for heme synthesis and incorporation.

Methodological approaches to study these processes include:

  • RNA stability assays using rifampicin to block new transcription

  • Polysome profiling to assess translation efficiency

  • Pulse-chase experiments to track protein synthesis and membrane integration

  • In vitro translation systems with added membranes to study integration mechanisms

What environmental conditions trigger maximum narI expression?

Maximum narI expression occurs under specific environmental conditions that mimic the natural ecological niche where nitrate respiration provides a selective advantage:

Environmental FactorOptimal ConditionEffect on narI Expression
OxygenAnaerobicStrong induction (via FNR)
NitratePresent (5-20 mM)Strong induction (via NarL/NarP)
NitriteLow concentrationsModerate induction
pH6.8-7.5Optimal expression
Temperature37°COptimal expression
Carbon sourceGlucose or glycerolEnhanced expression compared to succinate

To investigate these effects experimentally, researchers commonly use:

  • Controlled bioreactor cultures with defined gas mixtures and redox monitoring

  • qRT-PCR or Northern blotting to quantify narI mRNA levels

  • Western blotting with anti-NarI antibodies to quantify protein levels

  • Activity assays measuring nitrate reduction rates as a proxy for functional expression

  • Flow cytometry with fluorescent reporter fusions to monitor expression at the single-cell level

What are the optimal conditions for expressing recombinant NarI in E. coli?

Expressing functional recombinant NarI presents several challenges due to its membrane localization and requirement for heme incorporation. The following optimized protocol typically yields the best results:

  • Expression System:

    • Host strain: E. coli C43(DE3) or C41(DE3) (Walker strains designed for membrane protein expression)

    • Vector: pET-based with a C-terminal His-tag (avoid N-terminal tags that may interfere with membrane insertion)

    • Promoter: T7 with lac operator for controlled induction

  • Growth Conditions:

    • Medium: Terrific Broth supplemented with 0.5% glycerol

    • Temperature: Initial growth at 37°C to OD600 of 0.6-0.8, then shift to 18-20°C for induction

    • Aeration: Initially aerobic, then switch to microaerobic conditions (limited aeration) during induction

    • Inducer: 0.1-0.4 mM IPTG (lower concentrations often yield better results)

    • Induction time: 16-20 hours at the lower temperature

  • Supplements:

    • δ-aminolevulinic acid (0.5 mM) to enhance heme biosynthesis

    • Iron sulfate (0.1 mM) to support heme formation

    • Sodium nitrate (10-20 mM) to induce the native nitrate respiration machinery

  • Co-expression:

    • For optimal complex formation, co-express with narG, narH, and narJ

    • Consider using a polycistronic construct or dual plasmid system

This approach balances the need for sufficient protein production while avoiding aggregation and improper folding that often occurs with membrane proteins expressed at high levels.

What purification methods yield the highest purity and activity for recombinant NarI?

Purifying functional NarI requires special consideration due to its membrane localization and heme content. A methodological workflow that preserves structure and function includes:

  • Membrane Preparation:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol)

    • Disrupt cells by French press or sonication (maintaining temperature below 10°C)

    • Remove unbroken cells and debris (10,000 × g, 20 min, 4°C)

    • Ultracentrifuge to collect membranes (150,000 × g, 1 hour, 4°C)

  • Solubilization:

    • Resuspend membranes in solubilization buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol)

    • Add detergent gradually to final concentration:

      • n-Dodecyl-β-D-maltoside (DDM): 1-1.5%

      • or Digitonin: 1%

      • or Amphipol A8-35 for improved stability

    • Stir gently for 1-2 hours at 4°C

    • Ultracentrifuge to remove insoluble material (150,000 × g, 30 min, 4°C)

  • Affinity Chromatography:

    • Apply solubilized membranes to Ni-NTA or TALON resin

    • Wash with 10-15 column volumes of buffer containing 20 mM imidazole and 0.05% detergent

    • Elute with buffer containing 250-300 mM imidazole

  • Size Exclusion Chromatography:

    • Apply concentrated sample to Superdex 200 column

    • Elute with buffer containing 0.05% detergent

  • Activity Preservation:

    • Throughout purification, maintain reducing conditions (2 mM β-mercaptoethanol)

    • Include stabilizing additives (10% glycerol, 1 mM EDTA)

    • For long-term storage, consider detergent exchange to neopentyl glycol-based detergents

Activity assays should be performed at each purification step to track recovery of functional protein, typically using benzyl viologen or methyl viologen as artificial electron donors and measuring nitrate reduction spectrophotometrically.

How can one effectively measure NarI activity in both whole cells and purified preparations?

Measuring NarI activity requires consideration of its role in the complete nitrate reductase complex. Several complementary approaches provide comprehensive assessment:

  • Whole Cell Assays:

    • Methyl viologen-dependent nitrate reduction:

      • Grow cells anaerobically with nitrate

      • Harvest and wash cells in anaerobic buffer

      • Add reduced methyl viologen and nitrate

      • Monitor oxidation of methyl viologen at 600 nm

      • Calculate activity as μmol nitrate reduced/min/mg protein

    • Respiratory activity measurements:

      • Clark-type electrode to measure oxygen consumption rates

      • Shift from aerobic to anaerobic conditions with nitrate addition

      • Measure nitrite production colorimetrically using Griess reagent

  • Membrane Fraction Assays:

    • Quinol-dependent nitrate reduction:

      • Isolate membrane fractions containing NarGHI

      • Use ubiquinol-1 or menaquinol analogues as electron donors

      • Measure nitrite formation using Griess reagent

      • This assay specifically tests native electron flow through NarI

  • Purified Protein Assays:

    • Reconstituted proteoliposome assays:

      • Incorporate purified NarGHI into liposomes with defined lipid composition

      • Add quinol and nitrate

      • Monitor nitrite formation over time

    • Spectroscopic analysis:

      • Reduced-minus-oxidized difference spectra to identify heme b content

      • EPR spectroscopy to analyze heme environment and iron-sulfur clusters

A standard activity assay protocol involves:

  • Prepare samples in anaerobic buffer (50 mM MOPS pH 7.0, 5 mM MgCl2)

  • Add electron donor (1 mM benzyl viologen reduced with dithionite)

  • Initiate reaction with 10 mM sodium nitrate

  • Incubate at 30°C for defined time intervals

  • Stop reaction with zinc acetate

  • Measure nitrite formation using Griess reagent (540 nm)

  • Calculate specific activity as μmol nitrite formed/min/mg protein

What are the critical amino acid residues for NarI function and how do mutations affect activity?

NarI contains several critical amino acid residues essential for its structure and function:

Residue LocationFunctionEffect of Mutation
His56, His205Coordination of heme b₁Loss of heme binding; abolished electron transfer
His187, His211Coordination of heme b₂Reduced electron transfer from quinol to heme b₁
Arg112, Arg113Quinol binding siteDecreased affinity for quinol; lower activity
Glu215Proton transfer pathwayImpaired proton-coupled electron transfer
Transmembrane helices 1-5Membrane anchoringMislocalization; destabilization of complex

To experimentally analyze these residues:

  • Site-directed mutagenesis targeting conserved residues

  • Complementation assays in narI deletion strains (ΔnarI)

  • Spectroscopic analysis of heme incorporation in mutant variants

  • Activity assays comparing wild-type and mutant forms

  • Protein-protein interaction studies to assess complex formation

The most deleterious mutations typically involve the histidine residues coordinating heme groups, as these completely abolish electron transfer capability. Second-tier mutations affecting the quinol binding site typically reduce activity by 60-90% while maintaining some functionality.

How does the lipid environment affect NarI stability and function?

The lipid environment significantly impacts NarI stability and function, as this integral membrane protein depends on specific lipid-protein interactions:

  • Phospholipid Requirements:

    • Phosphatidylethanolamine (PE): Required for proper folding and activity; E. coli PE-deficient strains show reduced nitrate reductase activity

    • Phosphatidylglycerol (PG): Provides negative charge essential for optimal activity

    • Cardiolipin (CL): Concentrates at poles and septa where respiratory complexes often localize

  • Membrane Fluidity Effects:

    • Temperature-dependent changes in membrane fluidity affect electron transfer rates

    • Higher unsaturated fatty acid content improves low-temperature activity

    • Cholesterol or other sterols decrease activity when added to reconstituted systems

  • Experimental Approaches:

    • Reconstitution into liposomes with defined lipid compositions

    • Activity measurements in lipid-altered E. coli strains (pgsA, clsA mutants)

    • EPR spectroscopy to monitor heme environments in different lipid contexts

    • Fluorescence anisotropy measurements to correlate membrane fluidity with activity

  • Practical Implications:

    • Purification buffers should maintain critical lipids (add 0.02-0.05 mg/ml E. coli lipid extract)

    • Detergent choice affects lipid retention (milder detergents preserve more lipids)

    • Reconstitution protocols should include E. coli-mimicking lipid mixtures (70% PE, 20% PG, 10% CL)

In proteoliposome studies, researchers have found that activity can vary by 300-500% depending on lipid composition, with optimal activity requiring both PE and anionic phospholipids in proportions similar to the native E. coli membrane.

How does the NsrR regulatory protein affect narI expression in response to nitrosative stress?

NsrR serves as a critical regulatory link between nitrosative stress and the expression of nitrate reductase components, including narI. This relationship operates through both direct and indirect mechanisms:

  • Direct Regulation:
    While NsrR primarily regulates genes like hmpA, ytfE, and hcp-hcr as shown in the literature, there is evidence suggesting potential NsrR binding sites near the narGHJI promoter region . Under nitrosative stress, NO inactivates NsrR by reacting with its iron-sulfur cluster, relieving repression of target genes.

  • Indirect Regulation:

    • NsrR regulates the nrfA promoter, which controls expression of the periplasmic nitrite reductase . This enzyme can reduce NO to ammonia, affecting local NO concentrations that influence nitrate reductase expression.

    • NsrR regulates hmpA (encoding flavohemoglobin) which detoxifies NO, thereby modulating NO levels that affect other regulatory proteins involved in narI expression.

  • Integrated Regulatory Network:

    • FNR activity is inhibited by NO, creating a regulatory link between NsrR-controlled NO levels and FNR-dependent narGHJI expression

    • The NarL/NarP two-component systems interact with this network, as their activities are also modulated by nitrogen oxide species

To experimentally investigate these relationships:

  • Construct reporter fusions (narI promoter-lacZ) in wild-type and ΔnsrR backgrounds

  • Perform qRT-PCR analysis of narI expression under varying nitrosative stress conditions

  • Use chromatin immunoprecipitation (ChIP) to identify direct NsrR binding to the narGHJI promoter region

  • Deploy NO-releasing compounds (DETA NONOate, GSNO) at physiologically relevant concentrations to mimic stress conditions

What role do small RNAs play in post-transcriptional regulation of narI expression?

Small RNAs (sRNAs) play sophisticated roles in fine-tuning narI expression through post-transcriptional mechanisms:

  • Indirect Regulation through Transcription Factors:

    • SdsN₁₃₇ sRNA represses expression of the narP response regulator by pairing to the translation initiation region of its mRNA . Since NarP activates narGHJI expression in response to nitrate, this represents an important control point.

    • DicF sRNA appears to regulate narL mRNA levels . In enterohemorrhagic E. coli (EHEC), DicF deletion results in increased narL mRNA, suggesting DicF normally reduces NarL levels and consequently affects narGHJI expression.

    • RyhB may play a role in regulating both narP and narL expression, with some evidence suggesting it represses narP and activates narL in Salmonella .

  • Potential Direct Regulation:
    Although not explicitly documented in the provided search results, other sRNAs may directly target the narGHJI mRNA, affecting its stability or translation efficiency. The extensive 5' UTR of the narGHJI operon contains potential binding sites for regulatory RNAs.

  • Integration with Environmental Sensing:

    • The iron-responsive RyhB sRNA connects iron availability to nitrate respiration regulation, which is physiologically relevant as many enzymes in this pathway require iron cofactors.

    • The stress-responsive RpoS sigma factor influences SdsN levels, connecting general stress response to nitrate respiration.

  • Methodological Approaches:

    • RNA-RNA interaction validation using compensatory mutations

    • sRNA overexpression and deletion studies followed by qRT-PCR of narI

    • Translational reporter fusions to identify regulation at the translational level

    • MAPS (MS2-affinity purification coupled with RNA sequencing) to identify sRNAs interacting with narGHJI mRNA

This regulatory layer allows for rapid response to changing environmental conditions without new protein synthesis, providing energetic advantages when adjusting to fluctuating nitrate availability or redox conditions.

How does the coordination between NarI synthesis and membrane integration occur?

The coordination between NarI synthesis and membrane integration represents a sophisticated regulatory challenge that E. coli addresses through multiple mechanisms:

  • Transcriptional Coordination:

    • The narGHJI operon is transcribed as a polycistronic mRNA, ensuring stoichiometric production of all subunits

    • The gene order (narG, narH, narJ, narI) facilitates sequential translation and assembly

    • Transcription rate is matched to the capacity of membrane integration machinery

  • Translational Coupling:

    • Ribosome binding sites for each gene in the operon have different strengths

    • The narI translation initiation region is designed to produce NarI at appropriate levels relative to other subunits

    • Potential translational pausing allows time for proper membrane targeting

  • Co-translational Insertion Pathway:

    • NarI contains five transmembrane helices requiring SRP-dependent targeting

    • The signal recognition particle (SRP) recognizes the first transmembrane segment as it emerges from the ribosome

    • The SRP receptor (FtsY) guides the ribosome-nascent chain complex to the SecYEG translocon

    • YidC insertase assists in membrane integration and folding

    • SecDF-YajC complex may facilitate proper topology establishment

  • Heme Incorporation:

    • Heme b insertion occurs during or shortly after membrane integration

    • Timing of heme availability is coordinated with NarI synthesis

    • Protoporphyrin IX synthesis and iron insertion must occur in proximity to nascent NarI

  • Complex Assembly:

    • NarJ acts as a dedicated chaperone for NarGH assembly

    • NarJ prevents premature interaction with NarI until proper folding occurs

    • Final complex assembly is coordinated with cofactor insertion (hemes, iron-sulfur clusters, molybdenum cofactor)

Experimental approaches to study this process include:

  • Pulse-chase labeling combined with membrane fractionation

  • Site-specific photocrosslinking to capture transient interactions

  • Ribosome profiling to detect translational pausing

  • Conditional depletion of membrane insertion machinery components

  • In vitro translation systems supplemented with inner membrane vesicles

Disruption of this coordinated process through mutations or physiological stress can lead to aggregation of unincorporated NarI or assembly of non-functional complexes.

What are the most effective strategies for investigating NarI-quinol interactions?

Investigating NarI-quinol interactions requires specialized approaches due to the hydrophobic nature of both the protein and its electron donor:

  • Spectroscopic Approaches:

    • UV-visible spectroscopy to monitor heme reduction in the presence of quinols

    • EPR spectroscopy to characterize quinol binding site and electron transfer events

    • Resonance Raman spectroscopy to detect specific heme-quinol interactions

    • FTIR difference spectroscopy to identify amino acids involved in quinol binding

  • Binding Assays:

    • Isothermal titration calorimetry (ITC) using detergent-solubilized NarI and quinol analogues

    • Surface plasmon resonance (SPR) with immobilized NarI in nanodiscs

    • Fluorescence quenching using intrinsic tryptophan fluorescence or labeled quinol analogues

    • Equilibrium dialysis with radiolabeled quinols

  • Structural Biology Approaches:

    • Site-directed mutagenesis of predicted quinol-binding residues

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify regions with altered solvent accessibility upon quinol binding

    • Cryo-EM structure determination of NarGHI with bound quinol analogues

    • Computational docking and molecular dynamics simulations

  • Functional Assays:

    • Quinol-dependent nitrate reduction assays using different quinol derivatives:

      • Ubiquinol-1, -2 (water-soluble analogues)

      • Menaquinol-4 (more physiologically relevant under anaerobic conditions)

      • Duroquinol (stable synthetic analogue)

    • Measure kinetic parameters (Km, Vmax) for different quinols

    • Competition assays with quinol-like inhibitors (e.g., HQNO)

  • Practical Experimental Design:

    • Reconstitute NarI or NarGHI in nanodiscs or proteoliposomes for near-native environment

    • Control quinol autooxidation by maintaining strict anaerobic conditions

    • Use stopped-flow techniques to capture rapid electron transfer events

    • Develop photoactivatable quinol analogues for crosslinking studies

These approaches collectively provide insights into the mechanisms of quinol binding, the electron transfer pathway, and structure-function relationships at the membrane interface.

How can synthetic biology approaches be used to engineer NarI for enhanced electron transfer or altered substrate specificity?

Synthetic biology offers powerful tools to engineer NarI for enhanced performance or novel functions:

  • Rational Design Strategies:

    • Site-directed mutagenesis of quinol binding site residues to alter affinity or specificity

      • Arg112/Arg113 substitutions to modify electrostatic interactions

      • Introduction of additional aromatic residues to enhance π-stacking with quinol rings

    • Modification of heme coordination sphere to alter redox potentials

      • Second-sphere mutations that modify hydrogen bonding networks

      • Introduction of alternative axial ligands to replace histidines

    • Transmembrane domain engineering to optimize membrane integration and stability

      • Hydrophobic matching with membrane thickness

      • Introduction of stabilizing salt bridges at domain interfaces

  • Directed Evolution Approaches:

    • Development of selection systems based on:

      • Growth complementation in ΔnarI strains under nitrate-respiring conditions

      • Colorimetric screens for nitrite production

      • FACS-based screening with redox-sensitive fluorescent proteins

    • Error-prone PCR to generate diversity in the narI sequence

    • DNA shuffling with narI homologs from other bacteria

    • Focused mutagenesis of specific domains (e.g., quinol binding pocket)

  • Computational Design:

    • Machine learning approaches trained on electron transfer proteins

    • Rosetta-based design of improved stability or altered specificity

    • Molecular dynamics simulations to predict effects of mutations

    • Quantum mechanical calculations of electron transfer pathways

  • Domain Swapping and Chimeric Proteins:

    • Exchange transmembrane helices with related proteins (e.g., fumarate reductase subunits)

    • Create chimeras with alternative quinol-interacting domains

    • Fusion with electron transfer domains from other systems

  • Non-canonical Amino Acid Incorporation:

    • Introduction of metal-coordinating amino acids near heme groups

    • Incorporation of photo-switchable amino acids for light-controlled activity

    • Addition of click-chemistry compatible residues for post-translational modification

Successful engineering examples in related systems have achieved:

  • 2-3 fold increases in electron transfer rates

  • Shifts in substrate specificity from ubiquinol to menaquinol

  • Enhanced stability under oxidative stress conditions

  • Altered pH optima for specific applications

These approaches require careful validation using the activity assays described in previous sections, with special attention to potential unintended consequences on membrane integration and complex assembly.

What are the challenges and solutions for investigating NarI interactions with other components of the E. coli respiratory chain?

Investigating NarI interactions with other respiratory chain components presents several unique challenges that require specialized solutions:

  • Challenges in Studying Membrane Protein Interactions:

    • Hydrophobic nature of interaction interfaces

    • Transient interactions that may depend on membrane potential

    • Potential involvement of lipid components as interaction mediators

    • Difficulty in distinguishing specific from non-specific interactions in the crowded membrane environment

  • Methodological Solutions:

    A. In vivo Approaches:

    • FRET pairs expressed as fusion proteins with NarI and putative interaction partners

    • Split-GFP complementation assays for protein-protein interactions

    • In vivo crosslinking with photo-activatable amino acids at specific positions

    • Genetic suppressor screens to identify functional interactions

    B. Membrane-Mimetic Systems:

    • Nanodisc reconstitution with defined stoichiometry of components

    • Giant unilamellar vesicles (GUVs) with fluorescently labeled components

    • Supported lipid bilayers for atomic force microscopy studies

    • Native nanodiscs extracted directly from bacterial membranes

    C. Advanced Imaging:

    • Super-resolution microscopy (PALM/STORM) to visualize respiratory complex organization

    • cryo-electron tomography of bacterial membrane sections

    • High-speed AFM to capture dynamic interactions

  • Specific Interaction Partners to Investigate:

    Interaction PartnerExperimental ApproachExpected Outcome
    Quinone poolFluorescent quinone analogues; EPR spectroscopyCharacterization of quinone binding sites and mobility
    Alternative dehydrogenasesCo-immunoprecipitation; respiratory chain reconstitutionCompetition or cooperation for quinone access
    Cytochrome bd oxidaseMembrane fractionation; respiration inhibition studiesPotential supercomplex formation or quinone channeling
    NarK (nitrate/nitrite transporter)Bacterial two-hybrid; co-localization studiesPotential metabolic channeling of nitrate/nitrite
    F₁F₀ ATP synthaseProton motive force measurements; co-purificationFunctional coupling of electron transport to ATP synthesis
  • Data Integration Approaches:

    • Quantitative proteomics to determine stoichiometry of respiratory complexes

    • Metabolic flux analysis to identify functional interactions

    • Systems biology modeling of the complete respiratory network

    • Correlation of protein distribution with membrane potential using voltage-sensitive dyes

  • Technical Considerations:

    • Maintain anaerobic conditions throughout experiments

    • Use gentle solubilization conditions to preserve native interactions

    • Consider time-resolved measurements to capture dynamic associations

    • Validate in vitro findings with in vivo functional studies

By combining these approaches, researchers can build a comprehensive understanding of how NarI and the nitrate reductase complex integrate into the broader respiratory network of E. coli under different environmental conditions.

What are common issues in recombinant NarI expression and how can they be resolved?

Recombinant expression of membrane proteins like NarI frequently encounters challenges that require systematic troubleshooting:

  • Low Expression Levels:

    • Issue: Toxic effects on host cells due to membrane protein overexpression

    • Solutions:

      • Use specialized strains (C41/C43(DE3), Lemo21(DE3))

      • Reduce induction temperature to 18-20°C

      • Decrease inducer concentration (0.05-0.1 mM IPTG)

      • Use tightly controlled promoters (e.g., arabinose-inducible)

      • Consider auto-induction media for gradual expression

  • Improper Membrane Integration:

    • Issue: Formation of inclusion bodies rather than membrane insertion

    • Solutions:

      • Co-express chaperones (GroEL/ES, DnaK/J)

      • Add fusion partners that enhance membrane targeting (Mistic, YidC)

      • Optimize signal sequences or remove native signal if using recombinant tags

      • Ensure SRP pathway is not overwhelmed by reducing expression rate

  • Incomplete Heme Incorporation:

    • Issue: Production of apo-protein lacking heme cofactors

    • Solutions:

      • Supplement growth medium with δ-aminolevulinic acid (0.5 mM)

      • Add iron source (ferric citrate or ferrous sulfate, 0.1 mM)

      • Ensure sufficient oxygen during initial growth phase for heme biosynthesis

      • Consider co-expression of heme biosynthesis enzymes

  • Protein Instability:

    • Issue: Rapid degradation of recombinant NarI

    • Solutions:

      • Include protease inhibitors during all purification steps

      • Use strains lacking specific proteases (e.g., BL21)

      • Optimize buffer conditions (pH, salt concentration, glycerol content)

      • Maintain reducing environment with DTT or β-mercaptoethanol

      • Consider fusion with stability-enhancing partners (e.g., MBP)

  • Poor Complex Assembly:

    • Issue: Failure to assemble with NarG and NarH to form functional complex

    • Solutions:

      • Co-express all components (narGHJI) from a single vector or compatible vectors

      • Include the narJ chaperone which is essential for proper complex assembly

      • Express in a host with deleted native nar genes to prevent hybrid complex formation

      • Allow sufficient time post-induction for complete assembly (16-24 hours)

  • Experimental Monitoring Approaches:

    • Western blotting with anti-His or custom NarI antibodies

    • In-gel heme staining to specifically detect heme-containing proteins

    • BN-PAGE (Blue Native PAGE) to assess complex formation

    • Membrane fractionation to confirm localization

    • Absorption spectroscopy to quantify heme incorporation

Each troubleshooting iteration should modify only one parameter at a time, with careful documentation to identify optimal conditions for your specific experimental setup.

How can researchers distinguish between NarI and other similar membrane-bound cytochromes in complex samples?

Distinguishing NarI from other membrane-bound cytochromes requires a combination of biochemical, spectroscopic, and immunological approaches:

  • Spectroscopic Fingerprinting:

    • UV-visible spectroscopy:

      • NarI contains b-type hemes with characteristic absorption peaks

      • Reduced minus oxidized difference spectra show peaks at ~558-562 nm

      • Distinguish from:

        • Cytochrome bd (peaks at 628-632 nm from heme d)

        • Cytochrome bo₃ (peaks at 550-555 nm from heme o)

        • Cytochrome c (peaks at 550 nm with sharper bands)

    • EPR spectroscopy:

      • NarI hemes give distinctive g-values in reduced state

      • Low-temperature EPR can distinguish between different heme environments

      • Coupled iron-sulfur signals from NarH provide additional identification

  • Immunological Methods:

    • Specific antibodies against NarI:

      • Use peptide antibodies against unique regions of NarI

      • Western blotting with appropriate controls

      • Immunoprecipitation to isolate NarI-containing complexes

    • Epitope tagging strategies:

      • C-terminal His or FLAG tags on recombinant NarI

      • Use chromosomal tagging for physiological expression levels

      • Verification by mass spectrometry after affinity purification

  • Activity-Based Discrimination:

    • Substrate specificity:

      • NarI transfers electrons from quinol to the nitrate reduction pathway

      • Measure activity with specific inhibitors:

        • Antimycin A (inhibits bc₁ but not NarI)

        • Pentachlorophenol (inhibits NarI specifically at low concentrations)

        • HQNO (inhibits quinone-interacting proteins with different sensitivities)

    • Genetic approaches:

      • Use ΔnarI strains as negative controls

      • Complementation assays to confirm function

      • Site-directed variants with altered properties for identification

  • Mass Spectrometry Approaches:

    • Targeted proteomics:

      • Selected reaction monitoring (SRM) for NarI-specific peptides

      • Heavy-isotope labeled peptide standards for quantification

    • Heme-associated peptide analysis:

      • Identify peptides with covalently attached hemes

      • Distinguish b-type (non-covalent) from c-type (covalent) heme attachment

  • Practical Protocol for Complex Samples:

    1. Membrane fractionation to enrich respiratory complexes

    2. Solubilization with mild detergents (DDM or digitonin)

    3. BN-PAGE separation of intact complexes

    4. Second dimension SDS-PAGE to resolve individual subunits

    5. In-gel heme staining followed by western blotting

    6. Mass spectrometry of excised bands for definitive identification

This multi-faceted approach allows for robust identification of NarI even in samples containing multiple cytochromes with similar properties.

What controls should be included when studying NarI regulation and expression?

Rigorous experimental design for studying NarI regulation requires careful selection of controls to ensure valid and interpretable results:

  • Genetic Controls:

    • Deletion mutants:

      • ΔnarI - Essential negative control for specificity

      • ΔnarL/ΔnarP - To assess dependence on nitrate-responsive regulators

      • Δfnr - To evaluate anaerobic regulation dependency

      • ΔnsrR - To examine nitrosative stress response elements

    • Complementation controls:

      • Wild-type narI expressed from plasmid in ΔnarI background

      • Site-directed mutants to confirm specific regulatory elements

      • Heterologous expression of narI from related organisms

  • Expression Measurement Controls:

    • Internal standards:

      • Constitutively expressed genes (rpoA, gapA) as loading controls

      • Multiple reference genes with stability under experimental conditions

    • Reporter system controls:

      • Empty vector controls for reporter assays

      • Promoterless reporter constructs to assess background

      • Known regulated promoters (positive controls responding to same signals)

      • Mutated binding site controls to validate direct regulation

  • Environmental Condition Controls:

    • Oxygen availability:

      • Strict anaerobic conditions (verified by redox indicators)

      • Microaerobic controls to assess oxygen sensitivity

      • Aerobic controls as negative reference

    • Nitrate/nitrite conditions:

      • No added nitrate/nitrite baseline

      • Concentration gradients to establish dose-response

      • Alternative electron acceptors (fumarate, DMSO) as specificity controls

  • Temporal Controls:

    • Time course measurements to distinguish:

      • Direct vs. indirect regulatory effects

      • Transcriptional vs. post-transcriptional regulation

      • Expression vs. protein stability effects

    • Synchronization approaches:

      • Nutrient shift experiments with defined starting points

      • Inducible promoter systems for controlled expression timing

  • Technical and Validation Controls:

    • RT-qPCR controls:

      • No-template controls

      • No-reverse transcriptase controls

      • Melt curve analysis to confirm specificity

      • Standard curves for quantification

    • Protein detection controls:

      • Size markers appropriate for membrane proteins

      • Known cross-reactive proteins to assess antibody specificity

      • Subcellular fractionation controls (cytoplasmic, membrane markers)

  • Physiological Relevance Controls:

    • Growth rate and viability measurements

    • Nitrate consumption and nitrite production kinetics

    • Respiratory activity measurements (oxygen consumption, PMF generation)

    • Competitive fitness in mixed cultures

By systematically incorporating these controls, researchers can distinguish specific effects on narI regulation from broader physiological responses, technical artifacts, or indirect effects through other regulatory pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.