Recombinant Escherichia coli Respiratory nitrate reductase 2 gamma chain (narV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
narV; b1465; JW1460; Respiratory nitrate reductase 2 gamma chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
narV
Target Protein Sequence
MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLDKRGMVIWSNLFHIGI LGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLIGGAGLLWRRLTNQRVR ATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGWAQSIVTFRGGSSEMLNG VAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIVRSRR
Uniprot No.

Target Background

Function
This is a second nitrate reductase enzyme that can substitute for the NRA enzyme, enabling E. coli to utilize nitrate as an electron acceptor during anaerobic growth. The gamma chain is a membrane-embedded heme-iron unit resembling cytochrome b, responsible for transferring electrons from quinones to the beta subunit.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the respiratory nitrate reductase 2 gamma chain (narV) in Escherichia coli?

The respiratory nitrate reductase 2 gamma chain (narV) is a component of the secondary nitrate reductase system in E. coli. It functions as part of the membrane-associated nitrate reductase complex that catalyzes the reduction of nitrate to nitrite during anaerobic respiration. The narV gene is part of the narZYWV operon, which encodes the second nitrate reductase (NAR-Z) in E. coli, complementary to the primary nitrate reductase encoded by the narGHJI operon. This secondary system serves as a backup mechanism for nitrate reduction under specific environmental conditions. The gamma chain specifically functions as a membrane anchor component of the enzyme complex, facilitating electron transport during the nitrate reduction process .

Unlike the primary nitrate reductase, which is expressed under standard anaerobic conditions with nitrate, the narV-containing complex is expressed under different regulatory controls and often during stationary phase or stress conditions. Understanding narV's expression patterns and biochemical properties provides insights into E. coli's adaptability to various environmental conditions requiring nitrate-based respiration .

How does narV differ from components of the primary nitrate reductase system?

The narV gene product differs from its homolog in the primary nitrate reductase system (narI) primarily in its regulation and expression patterns. While both encode gamma chain components with similar structural features, they operate under different regulatory networks. The primary system (narGHJI) is directly regulated by the FNR and NarL transcription factors in response to anaerobic conditions and nitrate availability, whereas the narV-containing system responds to additional environmental cues .

Structurally, the narV protein shares significant sequence homology with narI but contains subtle differences in certain transmembrane domains that may affect its interaction with other components of the nitrate reductase complex. Functionally, the narV-containing complex typically shows lower nitrate reductase activity compared to the primary system but may offer advantages under specific stress conditions or during stationary phase growth .

What techniques are commonly used to study narV expression?

Several molecular and biochemical techniques are employed to study narV expression in E. coli. These include transcriptional fusions using reporter genes like lacZ, which can quantify promoter activity through β-galactosidase assays. For example, researchers frequently clone the narV promoter region into vectors like pRW50 to create transcriptional fusions that allow monitoring of expression under various conditions .

Quantitative PCR (qPCR) provides another powerful approach for measuring narV transcript levels, offering enhanced sensitivity for detecting expression under conditions where the gene may be weakly transcribed. Western blot analysis using antibodies specific to the NarV protein can confirm translation and protein accumulation. More advanced techniques include chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the narV promoter region, and electrophoretic mobility shift assays (EMSA) to study protein-DNA interactions at this locus .

How can I optimize recombinant expression of narV in E. coli expression systems?

Optimizing recombinant expression of narV requires careful consideration of several factors. First, select an appropriate expression vector and promoter system. While traditional IPTG-inducible systems like pET vectors can be employed, nitrate-responsive promoters provide an interesting alternative. The nitrate-inducible NarL-dependent promoters, such as those derived from the ogt and narG gene regions, offer tightly controlled expression that can be induced with inexpensive sodium nitrate .

The ogt104167 promoter shows particular promise, with high expression levels when properly induced with nitrate. For optimal results, E. coli strains lacking endogenous nitrate reductase activity (ΔnarG) should be considered to prevent depletion of the nitrate inducer from the growth medium. Growth conditions significantly impact expression: using minimal salts medium with controlled aeration maintains the nitrate concentration and ensures consistent induction .

Codon optimization of the narV sequence for E. coli expression may improve translation efficiency, particularly if expressing non-E. coli variants of the protein. Including an affinity tag (6×His) facilitates purification while having minimal impact on function. Expression should be monitored over time, with optimal harvesting typically occurring 3-4 hours post-induction, before inclusion body formation becomes problematic .

What are the best conditions for measuring narV-dependent nitrate reductase activity?

Measuring narV-dependent nitrate reductase activity requires carefully distinguishing it from the activity of the primary nitrate reductase system. The most effective approach is to use E. coli strains with genetic deletions of narG (encoding the alpha subunit of the primary nitrate reductase) to eliminate background activity. Anaerobic growth conditions are essential, typically achieved using sealed vessels with minimal headspace or anaerobic chambers .

The standard methyl viologen-dependent nitrate reductase assay provides reliable activity measurements. This spectrophotometric assay monitors the oxidation of reduced methyl viologen (which donates electrons) coupled to nitrate reduction. The reaction mixture typically contains phosphate buffer (pH 7.0), potassium nitrate (electron acceptor), and methyl viologen reduced with sodium dithionite. Activity is measured by monitoring the decrease in absorbance at 600nm as the reduced methyl viologen becomes oxidized during the reaction .

Temperature significantly affects enzyme activity, with optimal conditions typically being 30-37°C. Activity measurements should include proper controls, including samples without nitrate or with specific inhibitors like azide, which differentially affects various nitrate reductase systems. Membrane fractionation prior to activity assays can help isolate the membrane-bound narV-containing complex from cytoplasmic components .

How can I create a narV knockout strain for functional studies?

Creating a narV knockout strain requires precise genetic manipulation techniques. The most efficient modern approach utilizes lambda Red recombineering (recombination-mediated genetic engineering). This method involves replacing the narV gene with an antibiotic resistance marker through homologous recombination. The process begins with designing PCR primers that amplify an antibiotic resistance cassette (typically kanamycin resistance, kan^R) flanked by 40-50bp sequences homologous to regions immediately upstream and downstream of narV .

After transforming the PCR product into an E. coli strain expressing the lambda Red recombinase system (typically from plasmid pKD46), recombination events that replace narV with the antibiotic marker can be selected on appropriate media. The marker can subsequently be removed using the FLP recombinase system (from plasmid pCP20) if a marker-free deletion is desired, leaving behind only a small scar sequence .

Verification of successful knockout requires multiple approaches: PCR confirmation using primers flanking the deletion region, DNA sequencing to confirm the precise modification, and phenotypic testing for altered nitrate reductase activity. When combined with complementation studies (reintroducing narV on a plasmid), this system provides powerful tools for functional analysis. For P1 transduction-based approaches, the kanamycin resistance marker from existing knockout collections (like the Keio collection) can be transferred into your strain of interest .

How does the NsrR regulatory system interact with narV expression and function?

The NsrR regulatory system plays a significant role in nitrate/nitrite metabolism in E. coli, including potential interactions with narV expression. NsrR functions as a transcriptional repressor that responds to nitric oxide (NO), which can be generated during nitrate/nitrite reduction. When NO binds to NsrR, it relieves repression of genes involved in NO detoxification and response to reactive nitrogen species .

While direct regulation of narV by NsrR has not been definitively established in the provided literature, the interconnected nature of nitrate/nitrite reduction and NO metabolism suggests potential regulatory cross-talk. NsrR regulates several genes involved in nitrite reduction (such as nrfA) and NO detoxification (hmpA), which operate in metabolic pathways connected to narV function .

Experimental approaches to investigate potential NsrR-narV interactions include comparing narV expression in wild-type versus ΔnsrR strains under various nitrate/nitrite conditions, chromatin immunoprecipitation (ChIP) assays to detect NsrR binding to the narV promoter region, and gel retardation assays with purified NsrR protein and narV promoter fragments. Understanding these regulatory interactions provides insights into how E. coli coordinates multiple nitrogen oxide reduction pathways under different environmental conditions .

What role does narV play in E. coli's response to reactive nitrogen species?

The narV-containing nitrate reductase system likely contributes to E. coli's defense against reactive nitrogen species (RNS), though its specific role differs from dedicated detoxification systems. During nitrate reduction, the generation of nitrite and potential formation of reactive nitrogen intermediates necessitates coordinated expression of protective mechanisms. While narV primarily functions in energy generation through nitrate respiration, it may indirectly influence RNS levels by affecting the cellular nitrate/nitrite balance .

The primary protective systems against RNS in E. coli include the flavohemoglobin HmpA (which detoxifies NO), the di-iron protein YtfE (which repairs iron-sulfur centers damaged by NO), and the hybrid cluster protein HCP (potentially involved in hydroxylamine detoxification). These systems are regulated by NsrR and are induced under conditions of nitrosative stress .

How can narV be leveraged for biotechnological applications in synthetic biology?

The narV system offers several opportunities for biotechnological applications in synthetic biology. Its involvement in anaerobic respiration pathways makes it valuable for designing biocatalysts for denitrification processes in wastewater treatment or bioremediation of nitrate-contaminated environments. By engineering E. coli strains with optimized narV expression, researchers can develop more efficient biological systems for nitrate removal .

The regulatory elements controlling narV expression can be repurposed as genetic switches in synthetic circuits. The nitrate-responsive NarL-dependent promoters, similar to those used with other genes, could be adapted to control the expression of heterologous proteins or metabolic pathways that need to be activated under specific environmental conditions. This provides an inexpensive alternative to traditional inducers like IPTG, using readily available nitrate as an inducer .

The narV protein itself can be engineered through directed evolution or rational design to alter its catalytic properties, substrate specificity, or stability. Such modified versions might catalyze novel reactions of interest for bioproduction of chemicals or pharmaceuticals. Additionally, fusion proteins incorporating functional domains of narV might create bifunctional catalysts that couple nitrate reduction to other biochemical transformations of interest .

How do the expression patterns of narV compare across different E. coli strains and growth conditions?

Expression patterns of narV vary significantly across different E. coli strains and growth conditions, reflecting its specialized role in bacterial metabolism. In laboratory strains like MG1655, narV expression is typically low during exponential growth under standard aerobic conditions but increases during stationary phase and under specific stress conditions. In contrast, pathogenic E. coli strains may show different regulatory patterns, with some evidence suggesting altered expression during host colonization .

Nutrient availability plays an important role, with carbon source limitation often associated with increased narV expression. The table below summarizes these comparative expression patterns:

ConditionLaboratory Strains (e.g., MG1655)Pathogenic StrainsNotes
Aerobic growthLow expressionVariablePrimary nitrate reductase also repressed
Anaerobic + nitrateLow-moderate (strain dependent)Often elevatedPrimary system (narGHI) predominates
Anaerobic - nitrateModerate expressionGenerally elevatedExpression increases with oxygen limitation
Stationary phaseIncreased expressionHighly variableStress response may enhance expression
Carbon limitationEnhanced expressionEnhanced expressionPart of global metabolic adaptation
Nitrosative stressVariable upregulationOften upregulatedMay complement dedicated detoxification systems

What structural and functional differences exist between narV and its homologs in other bacterial species?

The narV protein exhibits significant structural and functional differences when compared to homologs in other bacterial species, reflecting evolutionary adaptations to different ecological niches. In E. coli, narV encodes a gamma chain that serves as a membrane anchor component with specific transmembrane helices and coordination sites for heme groups that facilitate electron transfer .

Denitrifying bacteria like Paracoccus denitrificans possess nitrate reductases with membrane components that share the core electron transfer function but exhibit specialized adaptations for complete denitrification pathways (reducing nitrate all the way to N₂). These structural differences affect substrate affinity, catalytic efficiency, and regulatory responses. Some extremophiles have evolved highly modified versions with enhanced stability under extreme pH, temperature, or salt conditions. These comparative differences provide valuable insights for protein engineering efforts aimed at creating variants with novel properties for biotechnological applications .

How do the narV-containing nitrate reductase complexes interact with other respiratory chain components?

The narV-containing nitrate reductase complexes interact with several other respiratory chain components to facilitate electron transfer during anaerobic respiration. The primary interaction occurs with quinones in the membrane, particularly menaquinone and demethylmenaquinone under anaerobic conditions. These quinones accept electrons from dehydrogenases that oxidize primary electron donors (like NADH or succinate) and transfer them to the nitrate reductase complex .

Within the respiratory chain organization, the narV component (gamma subunit) contains the binding site for quinones and facilitates electron transfer to the beta subunit (narY) through its heme groups. This electron flow continues through iron-sulfur clusters in the beta subunit to ultimately reach the catalytic alpha subunit (narZ) where nitrate reduction occurs. This arrangement physically separates the quinone-interacting components from the nitrate-reducing active site, allowing efficient coupling of electron transport to energy conservation .

The efficiency of these interactions affects the proton motive force generated during nitrate respiration. Unlike some other respiratory systems, the narV-containing complex does not directly pump protons but contributes to the proton gradient through the release of protons on the periplasmic side during quinol oxidation. This process is influenced by the membrane potential and pH gradient, creating feedback mechanisms that regulate the activity of the entire respiratory chain. Under certain conditions, narV-containing complexes may compete with other terminal reductases (like fumarate reductase) for the limited pool of reduced quinones, necessitating regulatory mechanisms to optimize respiratory efficiency .

What are common challenges in purifying functional recombinant narV and how can they be addressed?

Purification of functional recombinant narV presents several challenges due to its nature as a membrane protein and its involvement in multi-subunit complexes. The primary challenge is maintaining the native conformation during extraction from membranes. Traditional detergents like Triton X-100 or n-dodecyl-β-D-maltoside (DDM) may solubilize the protein but often disrupt important protein-lipid interactions essential for activity. Using milder detergents or amphipols can help preserve functional integrity during extraction .

Inclusion body formation represents another common issue when overexpressing membrane proteins like narV. This can be mitigated by lowering induction temperature (to 16-25°C), reducing inducer concentration, or using specialized E. coli strains designed for membrane protein expression (like C41(DE3) or C43(DE3)). Co-expression with chaperones such as GroEL/GroES may also improve folding efficiency .

The Table below outlines common purification challenges and potential solutions:

ChallengeUnderlying CauseSolution Strategies
Poor solubilizationHydrophobic membrane protein natureOptimize detergent type and concentration; use mild detergents (DDM, LMNG); consider native nanodiscs
Loss of heme groupsDisruption of coordination sitesInclude heme precursors in growth medium; purify under reducing conditions; avoid harsh pH conditions
Low yieldToxicity to host cellsUse controlled expression with nitrate-inducible promoters; lower induction temperature; use specialized host strains
Aggregation during purificationImproper folding or detergent removalInclude stabilizing additives (glycerol 10-20%); maintain samples at 4°C; use gradient elution
Loss of activityDissociation from other subunitsConsider co-expression with narY and narZ; purify entire complex rather than individual components
Contaminating proteinsNon-specific binding to affinity resinsUse more stringent washing conditions; consider tandem purification with dual affinity tags

How can I accurately measure narV expression levels in different genetic backgrounds?

Accurately measuring narV expression levels across different genetic backgrounds requires a combination of complementary techniques to overcome challenges related to its typically low expression levels. Quantitative reverse transcription PCR (RT-qPCR) provides the most sensitive method for detecting narV mRNA, requiring careful primer design to ensure specificity, particularly given sequence similarities with narI. Reference genes for normalization should be selected based on stability across the experimental conditions, with gyrA or rpoD often serving as reliable candidates in E. coli .

Western blotting offers protein-level detection but requires highly specific antibodies. If commercial antibodies against narV are unavailable, epitope tagging (such as adding a C-terminal 6×His tag) facilitates detection using commercial anti-tag antibodies. Importantly, membrane fractionation prior to analysis concentrates the target protein and removes cytoplasmic contaminants, improving detection sensitivity. Quantification should include appropriate loading controls specific to membrane proteins, such as TolC .

For higher throughput analysis, transcriptional fusions linking the narV promoter to reporter genes provide valuable tools. The lacZ reporter system offers quantitative measurements through β-galactosidase assays, while fluorescent reporters like GFP enable real-time and single-cell expression monitoring. When designing these constructs, include sufficient upstream sequence (typically at least 500bp) to capture all relevant regulatory elements. Statistical analysis across biological replicates is essential, particularly when comparing subtle differences between genetic backgrounds .

What analytical techniques best distinguish between the activities of primary and secondary nitrate reductase systems?

Distinguishing between the activities of primary (NarGHI) and secondary (NarZYV) nitrate reductase systems requires specialized analytical approaches that exploit their biochemical and genetic differences. Genetic approaches provide the cleanest differentiation, using strains with specific deletions: ΔnarG strains eliminate the primary system activity, while ΔnarZ strains lack the secondary system. Double deletion strains (ΔnarG ΔnarZ) can serve as negative controls to establish baseline measurements .

Biochemical methods exploit differences in enzymatic properties between the two systems. The primary system typically shows higher specific activity and different kinetic parameters (Km, Vmax) compared to the narV-containing system. By performing enzyme kinetics assays across a range of substrate concentrations, researchers can mathematically resolve mixed activities through non-linear regression analysis. Additionally, the two systems show differential sensitivity to certain inhibitors, with the primary system often showing greater sensitivity to cyanide, while both are inhibited by azide .

Proteomic approaches using targeted mass spectrometry can directly quantify the abundance of specific protein components from each system. Selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) methods targeting unique peptides from NarG versus NarZ, or NarI versus NarV, provide highly specific quantification even in complex membrane samples. When combined with activity measurements, these proteomic data allow calculation of specific activities that clearly distinguish the contributions of each system to the observed nitrate reduction .

What are promising research avenues for understanding narV regulation under stress conditions?

Several promising research avenues could advance our understanding of narV regulation under stress conditions. Single-cell expression analysis using microfluidic systems combined with fluorescent reporters would reveal population heterogeneity in narV expression during stress responses. This approach could identify potential bet-hedging strategies where subpopulations maintain different levels of narV expression to prepare for environmental fluctuations. Time-resolved studies during the transition between different stress conditions would be particularly informative .

Genome-wide approaches like ChIP-seq for various stress-responsive transcription factors could identify previously unrecognized regulators that bind the narV promoter region under specific conditions. Candidates include OxyR and SoxRS (oxidative stress), RpoS (general stress), RclR (reactive chlorine species), and various two-component systems responding to envelope stress. Complementary RNA-seq analysis comparing wild-type and regulatory mutant strains under various stresses would establish the functional significance of these interactions .

The role of post-transcriptional regulation represents another understudied area. Investigating how small RNAs, RNA-binding proteins, or differential mRNA stability affect narV expression under stress conditions could reveal important regulatory mechanisms. The potential impact of post-translational modifications on NarV protein activity during stress adaptation—including phosphorylation, acetylation, or redox-based modifications—warrants exploration using targeted proteomic approaches. These studies would provide a comprehensive understanding of how E. coli integrates multiple stress signals to modulate narV expression and function .

How might systems biology approaches enhance our understanding of narV in the context of E. coli metabolism?

Systems biology approaches offer powerful frameworks for understanding narV in the broader context of E. coli metabolism. Genome-scale metabolic models incorporating nitrate respiration pathways can predict how narV activity affects metabolic flux distributions under various environmental conditions. Constraint-based modeling approaches like Flux Balance Analysis (FBA) can identify conditions where the narV-containing system becomes essential for optimal growth or fitness, particularly when the primary system is inactive or saturated .

Multi-omics integration represents another powerful approach. By correlating transcriptomic, proteomic, and metabolomic data across conditions that differentially affect narV expression, researchers can identify novel relationships between narV activity and unexpected metabolic pathways. This approach might reveal how narV-dependent nitrate reduction influences amino acid metabolism, nucleotide synthesis, or lipid composition—connections that might not be obvious from traditional targeted studies .

Network-based approaches examining protein-protein interaction networks can elucidate how NarV physically interacts with other cellular components beyond its immediate complex partners. Techniques like BioID or APEX proximity labeling could identify proteins that physically associate with NarV in the membrane, potentially uncovering novel functional relationships. Agent-based modeling of entire bacterial populations in fluctuating environments could predict how heterogeneity in narV expression influences population survival under rapidly changing conditions, such as transitions between aerobic and anaerobic environments or exposure to antimicrobial agents .

What potential exists for engineering narV-based systems for biotechnological applications?

The engineering of narV-based systems holds significant potential for various biotechnological applications. Biosensor development represents one promising direction, where the narV promoter or modified versions could drive reporter gene expression in response to specific environmental signals. Such biosensors could monitor nitrate/nitrite levels in environmental samples, wastewater treatment processes, or even in situ during bioremediation efforts. Engineering the sensitivity and specificity of these promoters through directed evolution or rational design could create tailored sensing systems .

For bioremediation applications, optimized narV expression in engineered bacteria could enhance nitrate removal from contaminated groundwater or agricultural runoff. By manipulating the regulatory elements controlling narV and potentially engineering the protein itself for improved catalytic efficiency or stability, researchers could develop specialized bioremediation strains. These enhanced organisms might operate efficiently in challenging environments where natural denitrification is insufficient .

In bioproduction contexts, the nitrate-responsive elements regulating narV expression offer advantages as inducible systems for heterologous protein production. As demonstrated with other protein expression systems, nitrate-inducible promoters provide inexpensive alternatives to traditional inducers like IPTG. Further optimization through promoter engineering could enhance expression strength, reduce leakiness, or create systems with graded responses to different nitrate concentrations. By combining these expression systems with metabolic engineering approaches, researchers could develop strains that couple growth on nitrate to the production of valuable biochemicals or biopharmaceuticals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.