Recombinant Escherichia coli Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression Systems

  • Expressed in E. coli (e.g., strain MG1655/pKD46) using arabinose-inducible systems .

  • Yields: 1–2.5 mg per liter of culture after affinity chromatography (glutathione-Sepharose or Ni-NTA) .

Enzymatic Activity

  • Catalyzes intramembrane proteolysis of substrates with transmembrane domains (e.g., Spitz, Bla-LY2-MBP) .

  • Cleavage occurs at hydrophilic juxtamembrane regions (e.g., between Ser and Asp residues) .

Membrane Interaction

  • Induces thinning of E. coli-like membranes (POPE/POPG) by ~1.1 Å per leaflet, enhancing protease activity .

  • Catalytically inactive mutants (e.g., S201A, H254A) retain membrane-remodeling capabilities, suggesting structural roles .

Kinetic Parameters

  • Optimal activity in hydrophobic membranes (24–26 Å thickness) .

  • Inhibited by mutations in cytoplasmic regions (e.g., Arg227) and N-terminal residues preceding TMDs .

Key Research Findings

Role in Bacterial Fitness

  • Essential for E. coli extraintestinal pathogenic (ExPEC) gut colonization: ΔglpG mutants show >120-fold reduction in survival in murine models .

  • Polar effects on downstream glpR (a glycerol metabolism regulator) impair growth on oleate or mucus in vitro but not in vivo .

Substrate Recognition

  • Prefers substrates with specific transmembrane features (e.g., LacY-derived regions) .

  • Activity-based profiling using fluorophosphonate probes confirms active-site accessibility to cytoplasmic regions .

Applications

  • Structural Studies: NMR and crystallography to resolve membrane-protein interactions .

  • Vaccine Development: Antigen candidate for E. coli pathogens (e.g., uropathogenic strains) .

  • Enzymology: Model enzyme for studying rhomboid protease mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; b3424; JW5687; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Gene References Into Functions
  1. This study presents a detailed protocol for optimizing expression and purification of three rhomboid proteases from Escherichia coli (ecGlpG), Haemophilus influenzae (hiGlpG), and Providencia stuartii (AarA). PMID: 28065266
  2. The rhomboid protease GlpG was found to promote extraintestinal pathogenic Escherichia coli survival within the mouse intestinal tract in the presence of the intact natural microbiota. PMID: 28373355
  3. The unbinding of TM5 from the rest of the structure exposes GlpG's active site, consistent with studies of the catalytic mechanism of GlpG that suggest TM5 serves as a substrate gate to the active site. PMID: 26858402
  4. This study investigated high-resolution structures of the catalytic transmembrane domain of the Escherichia coli GlpG rhomboid. This provided numerous insights that help explain how hydrolytic cleavage can be achieved below the membrane surface. PMID: 25307614
  5. This research performed kinetic folding and unfolding experiments on 69 mutants (engineered every 2-3 residues throughout the 178-residue transmembrane domain) of GlpG, a membrane-embedded rhomboid protease from Escherichia coli. PMID: 26056273
  6. Peptidyl-chloromethylketones (CMKs) derived from the natural rhomboid substrate TatA from bacterium Providencia stuartii bind GlpG in a substrate-like manner, and their co-crystal structures with GlpG reveal the S1 to S4 subsites of the protease. PMID: 25216680
  7. This study focused on the structure and mechanism of rhomboid protease. PMID: 23585569
  8. Data indicate that the rhomboid GlpG (ecGlpG) cytoplasmic domain exists as a dimer with extensive domain swapping between the two monomers. PMID: 23353827
  9. GlpG is a rhomboid membrane protease that recognizes features of transmembrane regions of substrates. Cleavage occurs between Ser & Asp in a region of high local hydrophilicity, which might be located juxtamembrane rather than intramembrane position. PMID: 16216077
  10. This research involved the determination of the 2.1 A resolution crystal structure of the GlpG core domain. PMID: 17051161
  11. One of the two GlpG molecules in the asymmetric unit has an open conformation at the active site, with the transmembrane helix alpha5 bent away from the rest of the molecule. PMID: 17099694
  12. This study presents the crystal structure of GlpG in a more open conformation, where the capping loop L5 has been lifted, exposing the previously buried and catalytically essential Ser-201 to outside aqueous solution. PMID: 17277078
  13. Functional analyses have identified transmembrane helix 5 movement to gate lateral substrate entry as a rate-limiting step in intramembrane proteolysis. PMID: 17463085
  14. These results suggest that GlpG cleaves an extramembrane region of substrates, unlike the currently prevailing view that this class of membrane proteases acts against a membrane-embedded polypeptide segment. PMID: 17493126
  15. The L1 loop is partially embedded in the membrane, and showed that alanine substitution of a highly preferred tryptophan (Trp136) at the distal tip of the L1 loop near the lipid:water interface reduced GlpG proteolytic activity. PMID: 17976648

Show More

Hide All

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia coli GlpG and what is its fundamental role?

Escherichia coli GlpG is a membrane-embedded protease belonging to the widely conserved rhomboid family of membrane proteases. It functions as a key player in regulated intramembrane proteolysis (RIP), a process where proteins are cleaved within their transmembrane domains. GlpG traverses the bacterial membrane six times, creating a complex that can recognize and cleave substrate proteins at specific sites. The conserved serine and histidine residues of GlpG are essential for its proteolytic activities, confirming its classification as a serine protease despite its unusual membrane-embedded position. This enzyme represents an important model system for understanding the molecular mechanisms of intramembrane proteolysis across multiple domains of life .

What is the established membrane topology of GlpG?

GlpG displays a six-transmembrane topology that has been experimentally verified through various biochemical and structural approaches. The protein traverses the bacterial membrane six times, with both the N-terminus and C-terminus positioned on the cytoplasmic side. This topology creates a unique active site architecture where the catalytic residues are positioned within the membrane bilayer but accessible to substrate proteins through a lateral gate mechanism. The specific arrangement of these transmembrane segments creates a hydrophilic cavity within the membrane that enables water-dependent proteolysis to occur in an otherwise hydrophobic environment. This topology is critical for understanding substrate recognition and the catalytic mechanism of this intramembrane protease .

How does GlpG recognize and process its substrate proteins?

Research indicates that GlpG recognizes specific features of the transmembrane regions of its substrates rather than simply a linear amino acid sequence. In experimental studies, GlpG-dependent cleavage has been observed in model proteins containing a periplasmically localized β-lactamase domain, a transmembrane segment derived from LacY, and a cytosolic maltose binding protein domain. The cleavage site in these model substrates has been mapped to a region of high local hydrophilicity, potentially in a juxtamembrane rather than intramembrane position. When purified GlpG and purified model substrate proteins were used in in vitro assays, cleavage was documented to occur between serine and aspartic acid residues. This specific recognition mechanism suggests that GlpG may sense structural features of transmembrane segments, including helical instability, hydrophilic residues, or specific topological arrangements that facilitate substrate docking and subsequent proteolysis .

What are the optimal conditions for expressing and purifying functional recombinant GlpG?

For successful expression and purification of functional recombinant GlpG, researchers should consider several critical parameters. E. coli expression systems using BL21(DE3) strains with low-copy-number vectors containing the T7 promoter have proven effective. Expression should be induced at lower temperatures (16-20°C) to minimize protein aggregation and formation of inclusion bodies. Membrane fraction isolation followed by solubilization using mild detergents such as n-Dodecyl β-D-maltoside (DDM) or n-Decyl-β-D-Maltopyranoside (DM) is preferred, as these detergents better preserve the native structure and activity of GlpG compared to more harsh detergents.

Purification typically involves a combination of affinity chromatography (using polyhistidine tags) followed by size exclusion chromatography to achieve protein of high homogeneity. The buffer composition is critical, with optimal activity observed in buffers containing 50 mM Tris-HCl (pH 8.0), 150-300 mM NaCl, and 0.05-0.1% DDM. Glycerol (10%) can be added to enhance protein stability. Activity assays using fluorogenic peptide substrates or the model protein substrate described in the literature should be performed to confirm that the purified protein retains its proteolytic function .

What methods are available for quantifying GlpG proteolytic activity in vitro?

Several complementary methods can be employed to quantify GlpG proteolytic activity in vitro. The most direct approach involves using purified GlpG and purified model substrate proteins, such as the Bla-TM-MBP fusion protein described in the literature. In this assay, cleavage products can be separated by SDS-PAGE and quantified through densitometric analysis or western blotting. Additionally, researchers have developed fluorogenic peptide substrates that increase in fluorescence upon cleavage, allowing for real-time monitoring of proteolysis.

For more detailed kinetic analyses, researchers can use varying substrate concentrations and reaction times to determine enzymatic parameters including Km, Vmax, and kcat. HPLC or mass spectrometry can be used to identify and quantify specific cleavage products with high precision. When designing activity assays, researchers should carefully control the lipid or detergent environment, as membrane thickness significantly affects GlpG activity. For optimal activity, the hydrophobic membrane thickness should be maintained between 24 and 26 Å, which can be achieved by selecting appropriate lipid compositions for reconstitution experiments .

How can I design effective data tables for GlpG experimental results?

When designing data tables for GlpG experimental results, researchers should follow scientific conventions for clarity and comprehensiveness. Tables should have clear titles at the top that precisely describe the experimental parameters and measurements contained within. Each column should have a descriptive header that includes the measured variable and appropriate units. For independent variables (such as different GlpG mutants, substrate concentrations, or membrane compositions), these should typically be placed in the leftmost column, with dependent variables (such as activity measurements, binding affinities, or membrane thickness changes) in subsequent columns.

For example:

Table 1: Effect of Membrane Thickness on GlpG Proteolytic Activity

Lipid CompositionHydrophobic Membrane Thickness (Å)Membrane Thinning by GlpG (Å per leaflet)Relative Proteolytic Activity (%)
PC (18:1)27.1 ± 0.20.2 ± 0.162 ± 5
PC:PE (7:3)26.0 ± 0.30.5 ± 0.181 ± 7
PE:PG (7:3)25.3 ± 0.21.1 ± 0.2100 ± 6
PC (16:1)23.8 ± 0.40.1 ± 0.197 ± 8
PC (14:1)22.1 ± 0.30.0 ± 0.170 ± 9

Note: Values represent means ± standard deviation from three independent experiments. PC, phosphatidylcholine; PE, phosphatidylethanolamine; PG, phosphatidylglycerol. Activity values are normalized to the maximum activity observed in PE:PG membranes.2

Statistical significance indicators, sample sizes, and experimental conditions should be clearly stated either within the table or in accompanying footnotes. For mutation studies or structure-function analyses, include the specific amino acid changes and their positions relative to key structural domains2 .

How does membrane composition influence GlpG activity?

Membrane composition significantly influences GlpG activity through multiple mechanisms. Research has demonstrated that GlpG exhibits optimal proteolytic activity in membranes with a hydrophobic thickness between 24 and 26 Å. While phosphatidylcholine (PC) membranes are only negligibly altered by GlpG, in E. coli-relevant lipid compositions containing phosphatidylethanolamine (PE) and phosphatidylglycerol (PG), GlpG induces membrane thinning of approximately 1.1 Å per leaflet. This membrane remodeling appears to be a crucial aspect of GlpG function rather than simply an incidental effect.

The activity of GlpG shows a strong correlation with membrane thickness but interestingly does not display specific lipid headgroup preferences. This suggests that the physical properties of the membrane, particularly its thickness and elasticity, are the primary determinants of GlpG activity rather than specific chemical interactions with lipid headgroups. The induced local membrane thinning may serve multiple functions: it could facilitate substrate recruitment by reducing the energetic barrier for transmembrane substrate entry into the active site, create a microenvironment with reduced hydrophobicity to enable water-dependent proteolysis, or influence the conformational dynamics of both enzyme and substrate .

What structural features are essential for GlpG catalytic function?

Several structural features are critical for GlpG's catalytic function as an intramembrane protease. The catalytic mechanism depends on a conserved serine-histidine dyad, with these residues being absolutely essential for proteolytic activity. Mutational studies have confirmed that substitution of either the conserved serine or histidine residue abolishes proteolytic function. Unlike conventional serine proteases that utilize a catalytic triad, rhomboid proteases like GlpG appear to function with just two catalytic residues.

The active site of GlpG is positioned within a water-accessible cavity that is recessed into the membrane but shielded from the lipid bilayer. This architecture allows for hydrolytic chemistry to occur within an otherwise hydrophobic environment. A lateral gate mechanism is believed to allow substrate entry, where transmembrane helices of GlpG must undergo conformational changes to accommodate the substrate. The L1 loop region plays a critical role in gating substrate access and likely undergoes significant movement during the catalytic cycle.

Additionally, the enzyme contains a cavity that extends from the active site toward the periplasmic space, which may serve as the exit path for cleavage products or contribute to substrate specificity. The transmembrane domains TM2 and TM5 form key parts of the substrate-binding groove and contribute to determining which regions of substrate proteins can access the catalytic residues .

What is the relationship between GlpG and GlpR in E. coli metabolic regulation?

The relationship between GlpG and GlpR in E. coli represents an interesting example of genetic organization with functional implications. GlpR is encoded by a gene located downstream of glpG in the same operon. GlpR functions as a transcriptional repressor that regulates factors involved in glycerol degradation pathways. Research has revealed that disruption of glpG can have polar effects on the downstream glpR gene, highlighting the interconnected nature of these genes in bacterial metabolism.

The precise molecular mechanism by which GlpG influences carbon metabolism and bacterial survival in specific environments remains an active area of investigation. Current hypotheses include the possibility that GlpG cleaves membrane proteins involved in nutrient acquisition or stress responses, thereby regulating their activity or abundance. Alternatively, GlpG might process signaling proteins that coordinate metabolic adaptation to changing environmental conditions .

What role does GlpG play in bacterial pathogenesis?

GlpG has emerged as a significant factor in bacterial pathogenesis, particularly in Extraintestinal Pathogenic E. coli (ExPEC) strains. Research has demonstrated that GlpG contributes to bacterial persistence in the mammalian gastrointestinal tract. In mouse gut colonization models with unperturbed natural microbiota, the disruption of glpG significantly reduced ExPEC survival, revealing a novel biological role for this rhomboid protease in host colonization.

The mechanisms by which GlpG promotes bacterial persistence likely involve multiple pathways. One possibility is that GlpG-mediated proteolysis modifies bacterial surface proteins involved in adhesion, immune evasion, or interaction with host tissues. Alternatively, GlpG might process proteins involved in nutrient acquisition or stress responses that are critical for survival in the competitive gut environment. The impaired growth of glpG mutants in mucus and on media containing specific carbon sources supports the hypothesis that GlpG influences metabolic adaptation to host environments.

This connection between intramembrane proteolysis and bacterial pathogenesis opens new avenues for understanding how bacteria colonize and persist within hosts. Further research may reveal whether GlpG processes virulence factors directly or indirectly influences pathogenesis through broader effects on bacterial physiology. Understanding these mechanisms could potentially inform new approaches to preventing or treating infections caused by pathogenic E. coli strains .

How can I design gene knockout and complementation studies to investigate GlpG function?

For rigorous investigation of GlpG function through gene knockout and complementation studies, researchers should employ several methodological considerations. When constructing a glpG knockout strain, it's crucial to minimize polar effects on the downstream glpR gene. The PCR-mediated allelic replacement procedure described by Datsenko and Wanner has been successfully used to construct a glpG::cat allele that disrupts glpG at position 67 of the 276-amino-acid protein. This insertion point was specifically chosen because it inactivates function based on previous transposon insertion studies, while being upstream of the two promoters within glpG that transcribe the downstream glpR gene, thus avoiding polar effects .

For complementation studies, researchers should use plasmids containing the wild-type glpG gene under control of a regulatable promoter. To ensure proper expression levels, both low-copy-number plasmids (such as those with the pSC101 origin) and medium-copy-number plasmids (such as pBR322 derivatives) can be tested. Expression should be verified by immunoblotting using antibodies against GlpG or an epitope tag if incorporated into the construct.

To definitively distinguish between GlpG-specific and polar effects, a comprehensive complementation strategy should include: (1) the wild-type glpG gene alone, (2) the glpR gene alone, and (3) both genes together. Additionally, including catalytically inactive GlpG mutants (with mutations in the conserved serine or histidine residues) can help determine whether observed phenotypes depend on proteolytic activity or potentially on other structural functions of the protein. Phenotypic assays should include growth in different carbon sources, colonization models if relevant, and direct measurements of GlpG proteolytic activity using model substrates .

What techniques can be used to identify novel GlpG substrates in vivo?

Identifying novel GlpG substrates in vivo requires a multifaceted approach combining genetic, biochemical, and proteomic techniques. One powerful strategy involves comparative proteomics between wild-type and glpG deletion strains. This can be implemented through stable isotope labeling with amino acids in cell culture (SILAC) or tandem mass tag (TMT) labeling followed by mass spectrometry analysis. Proteins that accumulate in the glpG deletion strain but are processed in the wild-type strain represent potential substrates.

Another approach utilizes substrate-trapping mutants of GlpG. By replacing the catalytic serine with alanine or cysteine, researchers can create GlpG variants that bind but do not cleave substrates. These mutants can be affinity-purified along with trapped substrates, which are then identified by mass spectrometry. This technique has been particularly successful in identifying substrates of other intramembrane proteases.

Genetic screening approaches can also yield valuable insights. Synthetic genetic array (SGA) analysis, where a glpG deletion is combined with a genome-wide collection of gene deletions, can identify genetic interactions that suggest functional relationships. Similarly, multicopy suppressor screens, where overexpression libraries are transformed into glpG deletion strains with observable phenotypes, can identify proteins that functionally interact with GlpG.

For validation of putative substrates, researchers should demonstrate direct cleavage using purified components in reconstituted systems. Additionally, site-directed mutagenesis of the predicted cleavage sites in candidate substrates, followed by in vivo assessment of processing, provides strong evidence for authentic substrate relationships. Finally, phenotypic analysis comparing substrate deletion strains with glpG deletion strains can reveal biologically relevant substrate-protease pairs .

How do membrane thickness alterations by GlpG influence experimental design?

The ability of GlpG to alter membrane thickness has significant implications for experimental design in both in vitro and in vivo studies. When planning in vitro experiments with purified GlpG, researchers should carefully consider the lipid composition used for reconstitution. While phosphatidylcholine (PC) membranes are only negligibly altered by GlpG, a mix of phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) that mimics E. coli membrane composition shows significant thinning of approximately 1.1 Å per leaflet. This membrane remodeling directly impacts proteolytic activity, with optimal GlpG function observed in membranes with a hydrophobic thickness between 24 and 26 Å.

For activity assays, researchers should systematically vary membrane thickness to determine the optimal conditions for their specific experimental questions. This can be achieved by using lipids with different acyl chain lengths or degrees of unsaturation. Additionally, cholesterol or other sterols can be incorporated to modulate membrane thickness and rigidity. Importantly, membrane composition effects should be distinguished from specific lipid headgroup requirements by comparing lipids with identical headgroups but different acyl chains.

When designing liposome-based assays, the curvature of the membrane should also be considered, as highly curved membranes may exhibit different thickness properties than flat bilayers. Large unilamellar vesicles (LUVs) with diameters >100 nm are generally preferred over small unilamellar vesicles (SUVs) for minimizing curvature effects.

For in vivo studies, particularly those investigating GlpG function in different bacterial species or in heterologous expression systems, researchers should consider how differences in native membrane composition might affect GlpG activity. Complementation experiments should include appropriate controls for membrane thickness effects, potentially including membrane composition analysis of the different experimental conditions .

What are the current limitations in GlpG research and promising future directions?

Current GlpG research faces several limitations that present opportunities for future investigations. Despite significant progress in understanding the basic biochemistry and structure of GlpG, the full spectrum of its physiological substrates remains incompletely characterized. The biological significance of GlpG-mediated proteolysis in E. coli physiology, particularly in stress responses and metabolic adaptation, requires further elucidation. Additionally, while the connection between GlpG and bacterial persistence in host environments has been established, the molecular mechanisms underlying this relationship need deeper investigation.

Methodologically, studying membrane proteins like GlpG presents inherent challenges related to protein expression, purification, and reconstitution in membrane mimetics that faithfully recapitulate native conditions. The influence of membrane properties on GlpG activity adds another layer of complexity to experimental design and interpretation.

Promising future directions include the application of advanced proteomic approaches to comprehensively identify GlpG substrates across different growth conditions and stress responses. CRISPR-based screening methods could reveal genetic interactions that illuminate GlpG's role in bacterial physiology. Structural biology approaches, including cryo-electron microscopy of GlpG in complex with substrates, could provide crucial insights into the mechanisms of substrate recognition and processing. Single-molecule techniques might reveal the dynamics of GlpG-mediated proteolysis in real-time.

From a translational perspective, the role of GlpG in bacterial persistence suggests potential applications in developing novel anti-infective strategies. If GlpG processing of specific substrates proves essential for pathogen survival in host environments, inhibitors of this protease might represent a new class of antimicrobial agents with reduced selection pressure for resistance development .

How does E. coli GlpG compare to rhomboid proteases in other organisms?

Functionally, while E. coli GlpG appears to play roles in metabolic regulation and bacterial persistence, rhomboid proteases in other organisms often serve diverse signaling functions. In Drosophila, the rhomboid protease Rhom-1 processes the epidermal growth factor (EGF) ligand Spitz, activating EGF receptor signaling. In Plasmodium, rhomboid proteases cleave adhesins involved in host cell invasion. These diverse functions reflect the evolutionary adaptation of a common proteolytic mechanism to different biological contexts.

Substrate specificity also varies across rhomboid proteases. While E. coli GlpG recognizes features of transmembrane regions rather than specific sequences, some eukaryotic rhomboids display more stringent sequence preferences near the cleavage site. Additionally, the regulation of rhomboid activity differs across species, with some eukaryotic rhomboids subjected to complex post-translational modifications or protein-protein interactions that have not been observed for bacterial GlpG.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.