Recombinant Escherichia coli Sensor histidine kinase DcuS (dcuS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dcuS; yjdH; b4125; JW4086; Sensor histidine kinase DcuS; Fumarate sensor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
dcuS
Target Protein Sequence
MRHSLPYRMLRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVA RTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPF KGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSR WSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFEQRQAMLQSIKEGVVAVDD RGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRL LLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNYADALRERSHEFMNKLHVILG LLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSE SQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGI APDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGER SNR
Uniprot No.

Target Background

Function
DcuS is a member of the two-component regulatory system DcuR/DcuS. It plays a crucial role in C4-dicarboxylate-stimulated regulation of genes encoding the anaerobic fumarate respiratory system (including *frdABCD*, *nuoAN*, *dcuB*, *dcuC*, *sdhCDAB*, and others). It also weakly regulates the aerobic C4-dicarboxylate transporter *dctA*. DcuS activates DcuR through phosphorylation.
Gene References Into Functions
Supporting evidence:
  1. FRET and cross-linking data demonstrate the existence of full-length DcuS protein in an oligomeric state, including a tetramer, in living cells, bacterial membranes, and proteoliposomes. PMID: 20453099
  2. The periplasmic domain of *E. coli* DcuS contains a conserved cluster of positively charged or polar amino acid residues essential for fumarate-dependent transcriptional regulation. PMID: 15781452
  3. The DcuS-DcuR two-component system activates the transcription of structural genes in response to fumarate or its dicarboxylate precursors. PMID: 15995204
  4. Findings suggest that DcuS binds citrate (similarly to C4-dicarboxylates) via the C4-dicarboxylate portion of the molecule. PMID: 17416661
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is DcuS and what is its primary function in E. coli?

DcuS is a membrane-integral sensor histidine kinase that forms part of the two-component regulatory system DcuSR in Escherichia coli. Its primary function is to control the expression of genes involved in C4-dicarboxylate metabolism in response to extracellular C4-dicarboxylates such as fumarate or succinate. The DcuS protein has a distinct architecture with sensory and kinase domains located on opposite sides of the cytoplasmic membrane, enabling it to detect environmental signals and transmit them across the membrane to initiate cellular responses .

The sensor functions through autophosphorylation upon detection of C4-dicarboxylates, followed by phosphoryl group transfer to its cognate response regulator DcuR. This phosphorylation cascade ultimately leads to the binding of DcuR to specific promoter regions, particularly the dcuB promoter, thereby regulating gene expression in response to environmental stimuli .

How is DcuS structurally organized to facilitate signal transduction?

DcuS contains several distinct domains that work together for effective signal transduction:

  • An extracellular sensing domain that detects C4-dicarboxylates

  • A transmembrane domain that anchors the protein in the cell membrane

  • A cytoplasmic kinase domain that catalyzes autophosphorylation

This organization allows DcuS to function as a true transmembrane signal transducer. When reconstituted in liposomes made from E. coli phospholipids, DcuS can catalyze autophosphorylation by ATP with an approximate K(D) of 0.16 mM. The reconstituted DcuS shows a significant response to C4-dicarboxylates, with phosphorylation stimulated up to 5.9-fold by these compounds, while other carboxylates do not elicit this response .

What are the methodological considerations for isolating and reconstituting functional DcuS?

The isolation and reconstitution of functional DcuS requires several methodological considerations:

  • Protein Production: Overexpression of His-tagged DcuS (His6-DcuS) in E. coli, followed by careful cell lysis and membrane protein extraction.

  • Detergent Selection: Initial isolation in detergent-containing buffer is necessary, but researchers should note that detergent-solubilized DcuS shows limited functionality compared to reconstituted protein.

  • Reconstitution Process: Incorporation into liposomes made from E. coli phospholipids is crucial for restoring functionality. The reconstitution process typically involves:

    • Mixing purified DcuS with lipids in detergent solution

    • Controlled detergent removal via dialysis or adsorbent beads

    • Verification of proper protein orientation in the membrane

  • Functional Assessment: Once reconstituted, functionality can be assessed through autophosphorylation assays using [γ-33P]ATP, with successful reconstitution resulting in up to 7% of the reconstituted DcuS becoming phosphorylated .

The reconstituted system provides a defined in vitro system capable of complete transmembrane signal transduction from stimulus (fumarate) to DNA binding, making it invaluable for mechanistic studies .

How can researchers effectively measure DcuS-DcuR phosphotransfer activity?

Measuring the phosphotransfer activity between DcuS and DcuR requires a systematic approach:

  • Preparation of Phosphorylated DcuS: Reconstituted DcuS is incubated with [γ-33P]ATP under conditions that promote autophosphorylation, typically in the presence of C4-dicarboxylates like fumarate.

  • Phosphotransfer Reaction: The phosphorylated DcuS is then incubated with purified DcuR, with samples collected at different time points to monitor the kinetics of phosphotransfer.

  • Detection Methods:

    • Radiolabeling approach: Using [γ-33P]ATP and tracking the transfer of labeled phosphoryl groups

    • SDS-PAGE separation followed by autoradiography or phosphorimaging

    • Quantification of radioactive signals to determine phosphotransfer efficiency

  • Verification of DcuR Activity: Following phosphotransfer, the functionality of phosphorylated DcuR can be verified through DNA-binding assays, specifically examining binding to the dcuB promoter DNA .

This methodological approach allows researchers to assess both the kinetics and efficiency of phosphoryl group transfer in the DcuSR system, providing insights into the signal transduction mechanism.

How does DcuS interact with other sensor systems in E. coli's nutrient-sensing network?

DcuS functions within a complex network of nutrient-sensing systems in E. coli. While the search results don't directly describe interactions between DcuS and other systems, they do reveal important principles about how sensor histidine kinases can interact in bacterial signaling networks. For example:

The YehU/YehT and YpdA/YpdB histidine kinase/response regulator systems form a nutrient-sensing network that is activated at the transition to stationary phase. These systems show cross-regulation, where one system affects the expression of the target genes of the other system .

For researchers studying DcuS, this suggests several methodological approaches:

  • Cross-regulation Analysis: Investigate whether DcuS/DcuR regulates or is regulated by other two-component systems by examining gene expression in mutants lacking components of either system.

  • Protein-Protein Interaction Studies: The bacterial adenylate cyclase two-hybrid system can be used to detect heteromeric interactions between membrane-bound components of different signaling systems, as was demonstrated for YehU and YpdA systems .

  • Signaling Network Mapping: Construct comprehensive maps of nutrient-sensing networks by systematically analyzing the effects of mutations in one system on the activity of others.

The methodology used to identify interactions in the YehU/YehT and YpdA/YpdB systems provides a valuable template for investigating DcuS interactions .

What experimental approaches can detect interactions between DcuS and transporters or other membrane proteins?

Several experimental approaches can be used to investigate potential interactions between DcuS and other membrane proteins:

  • Bacterial Adenylate Cyclase Two-Hybrid System: This in vivo protein-protein interaction assay has been successfully used to detect heteromeric interactions between histidine kinases and transporters. The methodology involves:

    • Creating N- and C-terminal fusion constructs with adenylate cyclase fragments

    • Testing all possible combinations of fusion constructs

    • Measuring cAMP production (in Miller units) as an indicator of protein interaction

    • Using appropriate positive controls (e.g., yeast leucine zipper fusion constructs) and negative controls (e.g., unrelated membrane proteins)

  • Co-immunoprecipitation Studies: These can verify interactions detected in two-hybrid screens.

  • Functional Assays: Examining whether transport activity affects kinase function and vice versa.

For example, interactions between sensory proteins and transporters (the "trigger transporter mechanism") have been described in several bacterial systems, including the bacitracin resistance module BceS/BceAB in Bacillus subtilis and the cosensory systems DctA/DcuS and CadC/LysP in E. coli .

How can discrete choice experiments (DCEs) be adapted to optimize DcuS research protocols?

Discrete choice experiments (DCEs) offer a novel methodological approach for optimizing experimental protocols in DcuS research. While traditionally used in health economics, DCEs can be adapted to help researchers design more effective experiments by systematically evaluating preferences and trade-offs between different experimental parameters.

A DCE for DcuS research could be structured as follows:

  • Attribute Identification: Based on literature review and qualitative research, identify 5-7 key attributes affecting experimental outcomes, such as:

    • Buffer composition parameters

    • Lipid composition for reconstitution

    • Protein concentration ranges

    • Incubation times

    • Detection methods

  • Attribute Level Assignment: For each attribute, assign 2-4 realistic levels (e.g., different phospholipid compositions, varying ATP concentrations).

  • Experimental Design: Create choice tasks where researchers choose between alternative experimental protocols with varying attribute levels. This can be accomplished using:

    • Fractional factorial designs to reduce the number of choice tasks

    • Bayesian efficient designs to maximize statistical efficiency

  • Statistical Analysis: Analyze preferences using appropriate statistical models to determine the relative importance of each experimental parameter.

The output from such a DCE would provide quantitative guidance on optimal experimental conditions for DcuS studies, potentially improving reproducibility and efficiency .

What methodological challenges exist in studying signal transduction across the membrane by DcuS?

Studying transmembrane signal transduction by DcuS presents several methodological challenges:

  • Maintaining Protein Integrity: Ensuring that both the periplasmic sensing domain and cytoplasmic kinase domain remain functionally intact during purification and reconstitution.

  • Orientation Control in Reconstitution: Achieving the correct orientation of DcuS in artificial membranes is critical, as random orientation may reduce the apparent activity of the reconstituted system.

  • Signal Tracking Across Membrane: Following the conformational changes that occur during signal transduction requires specialized biophysical techniques.

  • Temporal Resolution: Capturing the kinetics of signal transmission from periplasmic binding to cytoplasmic kinase activation.

These challenges can be addressed through:

  • Systematic optimization of reconstitution protocols

  • Use of orientation-specific tags or antibodies

  • Employment of fluorescence resonance energy transfer (FRET) or other biophysical methods to track conformational changes

  • Development of rapid mixing and quenching techniques for kinetic studies

The successful reconstitution of DcuS into liposomes, as described in the search results, represents an important methodological advance that enables the study of complete transmembrane signal transduction in a defined in vitro system .

How do post-transcriptional mechanisms regulate DcuS-controlled gene expression?

While the search results don't directly address post-transcriptional regulation of DcuS-controlled genes, they provide insights into how related two-component systems are regulated at the post-transcriptional level. This information can inform research approaches for studying DcuS regulation:

The carbon storage regulator A (CsrA) has been shown to be involved in the post-transcriptional regulation of both yjiY and yhjX, which are target genes of the YehU/YehT and YpdA/YpdB systems, respectively. CsrA itself is regulated via sequestration by the Hfq-dependent small RNAs CsrB and CsrC .

For DcuS research, key methodological considerations include:

  • RNA Binding Protein Analysis: Investigate whether CsrA or other RNA binding proteins interact with transcripts of DcuS-regulated genes using:

    • RNA immunoprecipitation

    • Gel shift assays with purified proteins and target RNAs

    • Mutational analysis of potential binding sites

  • Small RNA Involvement: Examine the role of small RNAs in regulating DcuS-controlled gene expression through:

    • Small RNA sequencing in different growth conditions

    • Hfq mutant analysis

    • Small RNA overexpression studies

  • mRNA Stability Assessment: Determine if DcuS-regulated transcripts are subject to differential degradation using:

    • Rifampicin chase experiments to measure mRNA half-lives

    • RNase mutant studies to identify involved ribonucleases

The degradation of nutrient-sensing system transcripts can be under the control of multiple factors, including RNase E and ribosomal proteins like L4, which may restrain RNase activity and result in increased transcript levels .

What experimental approaches can differentiate direct from indirect effects in DcuS signaling networks?

Differentiating direct from indirect effects in DcuS signaling networks requires carefully designed experimental approaches:

  • Phosphorylation Site Mutagenesis: Create point mutations in the conserved histidine residue of DcuS and aspartate residue of DcuR to distinguish direct phosphotransfer from indirect signaling effects.

  • In Vitro Reconstitution Studies: Using purified components to demonstrate direct interactions and signal transduction, as shown in the search results where reconstituted DcuS was able to autophosphorylate in response to C4-dicarboxylates and transfer the phosphoryl group to DcuR .

  • Temporal Analysis of Signaling Events: Establish the sequence and timing of molecular events following signal detection using:

    • Time-course experiments with rapid sampling

    • Synchronized cell populations

    • Pulse-chase labeling of phosphorylated proteins

  • Genetic Suppressor Screens: Identify components that can bypass or amplify specific steps in the signaling pathway.

  • Chromatin Immunoprecipitation (ChIP) Analysis: Determine direct binding sites of response regulators on DNA following activation by sensor kinases.

Through these approaches, researchers can build a clearer picture of the direct signal transduction pathway from environmental signal detection to gene expression changes.

How should researchers interpret contradictory data when studying DcuS-mediated gene regulation?

When faced with contradictory data in DcuS research, a systematic approach to interpretation is essential:

  • Experimental Condition Variation: First, examine whether differences in experimental conditions might explain contradictory results:

    • Growth phase differences (as seen with YehU/YehT and YpdA/YpdB systems, which are activated at the transition to stationary phase)

    • Media composition variations, particularly carbon source availability

    • Strain background differences

    • Oxygen availability, which can affect C4-dicarboxylate metabolism

  • Multi-level Regulation Assessment: Consider that contradictions might reflect regulation at different levels:

    • Transcriptional control by DcuR

    • Post-transcriptional regulation by factors like CsrA

    • Protein-protein interactions affecting sensor kinase activity

    • Environmental factors affecting substrate availability

  • Cross-talk Analysis: Investigate whether other regulatory systems are interfering with DcuS signaling:

    • Test mutants lacking components of related two-component systems

    • Examine expression in the absence of transporters that might function as co-sensors

  • Quantitative Model Building: Develop mathematical models incorporating multiple regulatory inputs to reconcile apparently contradictory observations.

The search results demonstrate how the YehU/YehT and YpdA/YpdB systems exhibit complex cross-regulation, where each system affects the expression of the other system's target genes . Similar complexity might explain contradictory observations in DcuS studies.

What statistical approaches are most appropriate for analyzing DcuS phosphorylation kinetics data?

Analysis of DcuS phosphorylation kinetics requires appropriate statistical approaches:

  • Kinetic Parameter Estimation:

    • Non-linear regression for determining rates of autophosphorylation

    • Michaelis-Menten kinetics analysis for ATP binding (K(D) ≈ 0.16 mM)

    • First-order or second-order reaction kinetics for phosphotransfer to DcuR

  • Experimental Variation Handling:

    • Mixed-effects models to account for batch-to-batch variation in protein preparation

    • Bootstrap resampling for robust confidence interval estimation

    • Analysis of variance (ANOVA) to evaluate effects of different experimental conditions

  • Comparative Analysis:

    • Paired statistical tests when comparing DcuS activity in the presence vs. absence of C4-dicarboxylates

    • Multiple comparison corrections when testing several conditions

  • Dose-Response Modeling:

    • Hill equation fitting for analysis of ligand concentration effects

    • EC50 determination for comparing potency of different C4-dicarboxylates

When analyzing stimulation of DcuS phosphorylation by C4-dicarboxylates (up to 5.9-fold stimulation), researchers should consider both the magnitude of stimulation and the kinetics of the response to fully characterize the system's behavior .

What are the emerging techniques for studying DcuS structure-function relationships?

Several emerging techniques are advancing our understanding of DcuS structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM): Enables visualization of membrane proteins in near-native states, potentially revealing conformational changes during signal transduction.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies regions of proteins that undergo conformational changes upon ligand binding or activation.

  • Single-Molecule FRET: Allows direct observation of conformational dynamics in individual DcuS molecules during signaling.

  • Nanobody Development: Creation of conformation-specific nanobodies that can trap DcuS in specific signaling states.

  • Optogenetic Control: Engineering light-sensitive domains into DcuS to enable precise temporal control of activity for kinetic studies.

  • In-Cell NMR: Provides structural information about proteins within their native cellular environment.

These approaches can help researchers move beyond the reconstituted systems described in the search results to understanding DcuS function in more native contexts.

How can systems biology approaches enhance our understanding of DcuS in the broader context of E. coli metabolism?

Systems biology approaches offer powerful methods for understanding DcuS within E. coli's metabolic network:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to map the complete response to DcuS activation

    • Identify unexpected connections between C4-dicarboxylate metabolism and other cellular processes

  • Network Modeling:

    • Construct comprehensive models of nutrient-sensing regulatory networks

    • Integrate DcuS/DcuR with other two-component systems like YehU/YehT and YpdA/YpdB

    • Use computational approaches to predict emergent properties and system behaviors

  • Genome-Scale Metabolic Models:

    • Incorporate DcuS regulatory effects into genome-scale metabolic models

    • Predict metabolic flux changes in response to C4-dicarboxylates

    • Identify potential metabolic engineering targets

  • Single-Cell Analysis:

    • Examine cell-to-cell variability in DcuS signaling

    • Investigate the timing and coordination of DcuS activation in bacterial populations

  • Evolution and Adaptation Studies:

    • Examine how DcuS regulation evolves under different selective pressures

    • Compare DcuS function across related bacterial species

The search results suggest that nutrient-sensing regulatory networks, like the one formed by YehU/YehT and YpdA/YpdB, help coordinate nutrient scavenging and metabolic readjustment in preparation for the stationary phase . Similar systems biology approaches could reveal how DcuS contributes to these coordinated responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.