Recombinant Escherichia coli Sensor histidine kinase DpiB (dpiB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant DpiB

Recombinant DpiB is a histidine kinase expressed in E. coli and other heterologous systems (e.g., yeast, baculovirus). It is encoded by the dpiB gene (synonyms: citA, mpdB, ybeP) and functions as part of the CitA-CitB TCS . Key features include:

Table 1: Biochemical Properties of Recombinant DpiB

PropertyDetails
Gene NamedpiB (also citA, mpdB, ybeP, ECK0612, JW0611)
Molecular FunctionSensor histidine kinase (EC 2.7.13.3)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
ApplicationsEnzyme activity studies, antibody production, TCS research

Domain Architecture

DpiB contains:

  • Periplasmic sensor domain: Binds citrate and related ligands .

  • Transmembrane helices: Anchor the protein to the membrane .

  • Cytoplasmic kinase domain: Autophosphorylates a histidine residue, initiating phosphotransfer to CitB .

Ligand Binding Specificity

Isothermal titration calorimetry (ITC) revealed:

  • Citrate: Binds with a dissociation constant (KdK_d) of 0.15–1.0 µM .

  • Other ligands: Isocitrate and tricarballylate bind weakly, while malate does not .

Table 2: Ligand Binding Affinities

LigandKdK_d (µM)Binding Stoichiometry
Citrate0.15–1.0~0.9
Isocitrate~10Not reported
Tricarballylate~50Not reported

Biological Roles

  • Citrate metabolism regulation: Activates citCDEFXGT operon for citrate fermentation .

  • Plasmid stability: Destabilizes iteron-containing plasmids (e.g., pSC101) .

  • Virulence modulation: In pathogenic E. coli, DpiB homologs contribute to niche-specific colonization (e.g., urinary tract) .

Expression Systems

  • Host strains: Engineered E. coli strains (e.g., BL21(DE3)) optimize yield .

  • Vector design: pET or pBR322-based plasmids with inducible promoters (e.g., lacUV5) .

Challenges

  • Disulfide bond formation: Requires periplasmic expression or engineered strains (e.g., SHuffle® T7) with oxidative cytoplasm .

  • Solubility: Fusion tags (e.g., maltose-binding protein) improve solubility .

Research Applications

  • TCS studies: Used to dissect phosphorelay mechanisms in E. coli .

  • Antibody development: Polyclonal antibodies against DpiB enable Western blot and ELISA applications .

  • Metabolic engineering: Insights into citrate utilization aid industrial biotechnology .

Key Research Findings

  1. High-affinity citrate sensing: DpiB’s periplasmic domain binds citrate at submicromolar concentrations, making it a high-sensitivity receptor .

  2. Strain-dependent expression: Heterologous protein yields vary significantly across E. coli strains (e.g., ECOR collection) .

  3. Stress response linkage: Overexpression correlates with phage shock protein A (PspA) upregulation, suggesting cross-talk with stress pathways .

Challenges and Solutions

ChallengeSolution
Low solubilityUse solubility-enhancing tags (e.g., MBP)
ToxicityEmploy low-copy vectors or inducible promoters
MisfoldingCo-express chaperones (e.g., DsbC)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dpiB; citA; mpdB; ybeP; b0619; JW0611; Sensor histidine kinase DpiB; Sensor histidine kinase CitA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
dpiB
Target Protein Sequence
MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASFEDYLTLHVRDMAMNQ AKIIASNDSVISAVKTRDYKRLATIANKLQRDTDFDYVVIGDRHSIRLYHPNPEKIGYPM QFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVVSIGYLVSKIDSWRAEFL LPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVRQQEALFSSVYEGLIAVDP HGYITAINRNARKMLGLSSPGRQWLGKPIVEVVRPADFFTEQIDEKRQDVVANFNGLSVI ANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLL QMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLLFGKVQRARELGLKMIIVPGSQ LSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIVELFLSDEGDDVVIEVADQGCGV PESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRCGGVITLEDNDPCGTLFSIYIPKV KPNDSSINPIDR
Uniprot No.

Target Background

Function
DpiB is a member of the two-component regulatory system DpiA/DpiB, which is essential for the expression of citrate-specific fermentation genes and genes involved in plasmid inheritance. It may be involved in responding to both the presence of citrate and external redox conditions. DpiB acts as a sensor kinase, phosphorylating DpiA in the presence of citrate.
Gene References Into Functions
  1. DcuS/DcuR modulation of citA and citB expression. PMID: 22101843
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of E. coli Sensor Histidine Kinase DpiB?

DpiB is a full-length sensor histidine kinase in Escherichia coli consisting of 552 amino acids. The protein contains specific functional domains characteristic of two-component signal transduction system sensors. Based on structural analysis, DpiB (similar to other histidine kinases like EvgS) likely contains a sensor domain that perceives environmental stimuli, a transmembrane segment, and a cytoplasmic catalytic core where autophosphorylation occurs . The transmembrane regions facilitate signal transduction from the periplasmic environment to the cytoplasmic catalytic domain. According to available data, recombinant versions of DpiB can be expressed with an N-terminal His tag in E. coli expression systems to facilitate purification and functional studies . The protein sequence reveals characteristic motifs found in histidine kinase sensors that are critical for its signaling function.

How does DpiB function within bacterial two-component signaling systems?

DpiB, like other histidine kinases such as EvgS, functions as part of a two-component signal transduction system (TCS) that enables bacteria to respond to environmental changes. When specific stimuli are detected by the sensor domain, the protein undergoes autophosphorylation at a conserved histidine residue in the catalytic core . This phosphate group is subsequently transferred to a cognate response regulator, which then typically functions by regulating gene expression in response to the detected environmental conditions . The signaling mechanism involves a precise phosphotransfer reaction that transmits the detected signal to elicit appropriate cellular responses. Similar to other two-component systems, DpiB likely plays a crucial role in helping E. coli adapt to specific environmental conditions by modulating gene expression through its cognate response regulator.

What distinguishes DpiB from other histidine kinases in E. coli?

While E. coli contains numerous histidine kinases, DpiB possesses distinctive characteristics that differentiate it from other sensors. Unlike the EvgS histidine kinase which has a large periplasmic domain with Venus flytrap domains and responds to acidic signals, DpiB has its own unique domain architecture and likely responds to different environmental cues . Compared to unorthodox histidine kinases like EvgS that contain three catalytic domains (HK domain, intermediate receiver domain, and Hpt transmitter domain), DpiB may follow a more conventional two-component phosphotransfer mechanism . Additionally, the amino acid sequence of DpiB contains unique motifs that likely determine its specific function and interaction partners. The specificity of DpiB within the E. coli signaling network is determined by its unique sensory domain structure and its cognate response regulator interaction profile.

What are the optimal expression systems for producing recombinant DpiB protein?

For optimal expression of recombinant DpiB protein, E. coli-based expression systems have proven effective, particularly when the protein is tagged with an N-terminal His-tag for purification purposes . When designing expression systems, researchers should consider using E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21) as histidine kinases often contain transmembrane domains. The expression vector should contain an inducible promoter system (such as T7 or arabinose-inducible promoters) to control expression levels, as overexpression of membrane proteins can be toxic to host cells. Growth conditions typically involve induction at lower temperatures (16-25°C) to promote proper folding of the protein. For purification of DpiB, mild detergents should be used to solubilize the membrane-associated protein while maintaining its native conformation and activity. Experimental validation of protein expression should include Western blotting with anti-His antibodies similar to the methods used for analyzing other histidine kinases .

What methods are most effective for studying DpiB phosphorylation activity?

Several complementary approaches can be used to effectively study DpiB phosphorylation activity. In vitro phosphorylation assays using purified recombinant DpiB protein and γ-32P-ATP or γ-33P-ATP allow for direct measurement of autophosphorylation. For these assays, the reaction mixture typically contains the purified protein, ATP, and appropriate buffer components (usually containing Mg2+ as a cofactor). Phos-tag SDS-PAGE provides a non-radioactive alternative for detecting phosphorylated proteins by causing a mobility shift in phosphorylated forms. In vivo reporter systems can be constructed similar to the ydeP-lacZ reporter used for EvgS/EvgA studies, where β-galactosidase activity indicates activation of the signaling pathway . Mass spectrometry approaches, particularly phosphoproteomics, can identify exact phosphorylation sites and quantify phosphorylation levels. For kinetic studies of phosphorylation and phosphotransfer, researchers can employ stopped-flow techniques coupled with fluorescence detection to monitor real-time reactions.

How can researchers effectively create and characterize DpiB mutants to study structure-function relationships?

Creating and characterizing DpiB mutants requires a systematic approach focusing on conserved domains and critical residues. Site-directed mutagenesis should target catalytic residues (particularly the phosphorylatable histidine), potential sensory residues, and transmembrane regions. Similar to studies with EvgS, cysteine residues may be particularly important if redox sensing is involved in DpiB function . For phenotypic characterization, researchers should develop appropriate reporter systems that measure the output of the signaling pathway, similar to the β-galactosidase assays used for EvgS/EvgA . Complementation studies in dpiB knockout strains can confirm whether mutant versions retain functionality. Biochemical assays measuring phosphorylation and phosphotransfer activities of purified mutant proteins provide direct evidence of functional changes. Structural studies using techniques such as X-ray crystallography, cryo-EM, or NMR can reveal how mutations affect protein conformation. Molecular dynamics simulations can further predict how specific mutations might affect protein dynamics and signal transduction mechanisms.

What environmental signals are detected by DpiB and how can they be experimentally manipulated?

While the specific signals detected by DpiB have not been fully characterized in the provided search results, approaches similar to those used for other histidine kinases can be applied. Researchers should systematically test various environmental conditions including pH changes, oxidative/reductive stress, nutrient availability, and temperature fluctuations to identify DpiB-activating signals. Drawing from studies of EvgS, which responds to mildly acidic pH and oxidative conditions, experimental setups should include controlled environments with precise modulation of these parameters . Redox conditions can be manipulated using aerobic, semi-aerobic, and anaerobic growth conditions, as demonstrated in EvgS studies where activation was observed only under aerobic conditions . Chemical modulators such as electron carriers (ubiquinone, menaquinone) may be relevant for testing potential redox sensing by DpiB, similar to their role in EvgS activation . Genetic approaches involving deletion of genes in relevant metabolic pathways can help identify the molecular nature of the signal. Reporter assays measuring the activity of genes regulated by the DpiB signaling pathway provide quantitative readouts of activation levels under different conditions.

How does the transmembrane domain of DpiB contribute to signal transduction?

The transmembrane domain of DpiB plays a crucial role in transmitting signals from the periplasmic/extracellular environment to the cytoplasmic catalytic domains. This domain likely functions through conformational changes that propagate across the membrane, similar to other histidine kinases. Structure-function analysis should focus on identifying conserved residues within the transmembrane helices that might be involved in signal propagation. Researchers can employ cysteine-scanning mutagenesis followed by disulfide crosslinking studies to identify residues that change their relative positions during signaling. Fluorescence resonance energy transfer (FRET) experiments using fluorescent proteins fused to different domains can monitor conformational changes in real-time. Molecular dynamics simulations can predict how the transmembrane domain moves during signal transduction. Studies of chimeric proteins, where the transmembrane domain of DpiB is exchanged with that of another histidine kinase, can reveal whether this domain contributes to signal specificity or merely serves as a structural connector. Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling can provide detailed information about conformational changes in the transmembrane region during signaling.

What role might redox sensing play in DpiB function, similar to that observed in EvgS?

Based on findings from the EvgS histidine kinase, redox sensing may be a significant aspect of DpiB function that warrants investigation. Researchers should examine the DpiB sequence for redox-active cysteine residues in PAS domains or other cytoplasmic regions that might form disulfide bonds under oxidizing conditions, similar to the cysteines at positions 663, 671, and 683 in EvgS . Experimental approaches should include comparing DpiB activity under aerobic, semi-aerobic, and anaerobic conditions using appropriate reporter systems, as was done for EvgS which showed activation only under aerobic conditions . Mutation studies targeting cysteine residues can reveal their importance in redox sensing, similar to the C671A and C683A mutations in EvgS that allowed activation even under anaerobic conditions . The role of electron carriers of the respiratory chain should be investigated, particularly ubiquinone which was required for EvgS activation . Biochemical assays with purified DpiB protein can test the direct effect of oxidized and reduced electron carriers (such as UQ-0 and menadione) on kinase activity. Structural studies focusing on potential redox-sensing domains would provide insight into the molecular mechanisms of signal detection.

How can DpiB be used as a model system for studying two-component signal transduction?

DpiB offers several advantages as a model system for studying fundamental principles of two-component signal transduction. Researchers can leverage the relative simplicity of bacterial systems compared to eukaryotic signaling pathways to elucidate fundamental mechanisms of phosphotransfer and signal propagation. Systematic mutation of conserved residues in DpiB can reveal universal principles about histidine kinase function that apply across diverse bacterial species. The protein can serve as a platform for developing biosensors for specific environmental conditions if its activating signals are well-characterized. The integration of DpiB signaling with other cellular networks provides opportunities to study regulatory crossover between different signaling systems, similar to what has been observed with EvgS/EvgA and SafA-PhoQ/PhoP-IraM-RpoS networks . Comparative studies of DpiB with homologous histidine kinases from other bacterial species can illuminate evolutionary aspects of signaling system development. Advanced systems biology approaches including mathematical modeling and synthetic biology modifications can utilize DpiB to understand design principles of bacterial signaling networks.

What are the key methodological challenges in monitoring phosphorylation dynamics of DpiB in vivo?

Studying phosphorylation dynamics of DpiB in vivo presents several methodological challenges that researchers must address. The inherently transient nature of histidine phosphorylation makes it difficult to capture and quantify these events, as the phosphohistidine bond is labile under acidic conditions commonly used in protein analysis. Traditional phosphoproteomic methods optimized for serine, threonine, and tyrosine phosphorylation often fail to preserve histidine phosphorylation. Researchers should employ specialized approaches like neutral or basic pH conditions throughout sample preparation and analysis. Developing specific antibodies against phosphohistidine has proven challenging but represents an important tool for in vivo studies. The relatively low abundance of histidine kinases in bacterial cells necessitates sensitive detection methods or overexpression systems, which themselves may alter normal signaling dynamics. Temporal resolution of signaling events requires rapid sampling techniques that can capture the fast phosphorylation and dephosphorylation cycles. Integration of data from multiple experimental approaches (genetic, biochemical, and structural) is essential for a comprehensive understanding of in vivo phosphorylation dynamics.

How can structural studies of DpiB inform the development of antimicrobial strategies targeting two-component systems?

Structural studies of DpiB can significantly contribute to antimicrobial development strategies by revealing specific molecular features that could be targeted. High-resolution structural determination using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can identify potential druggable pockets within the protein, particularly at functionally critical regions like the ATP-binding site or signal-sensing domain. Structure-guided drug design approaches can utilize this information to develop small-molecule inhibitors that specifically disrupt DpiB function. Virtual screening of compound libraries against the structural model can identify potential inhibitors for experimental validation. Molecular dynamics simulations can reveal transient binding pockets and conformational changes that might be targeted. Fragment-based drug discovery approaches starting with small chemical moieties that bind to specific regions of DpiB can lead to the development of high-affinity inhibitors. The development of peptidomimetics that interfere with the interaction between DpiB and its cognate response regulator represents another potential strategy. Understanding the differences between bacterial histidine kinases and mammalian signaling proteins is crucial for developing selective antimicrobials with minimal host toxicity.

How does DpiB compare functionally with other well-characterized histidine kinases like EvgS and ArcB?

Comparative analysis reveals both similarities and differences between DpiB and other well-characterized histidine kinases. Unlike EvgS, which is an unorthodox histidine kinase with a large periplasmic domain containing Venus flytrap domains and three catalytic domains (HK, receiver, and Hpt), DpiB appears to have a more conventional structure . While EvgS responds to mildly acidic pH conditions and activates acid resistance genes, DpiB likely responds to different environmental signals given its distinct domain architecture . Regarding redox sensing, EvgS is activated under aerobic conditions and requires ubiquinone for activation, suggesting a redox-sensing mechanism involving cysteine residues in its cytoplasmic PAS domain . ArcB, another unorthodox histidine kinase, responds to changing respiratory conditions and is regulated by quinones that oxidize redox-active cysteine residues in its cytoplasmic PAS domain . Whether DpiB employs similar redox-sensing mechanisms would require experimental verification. The signaling specificity of these different histidine kinases is likely determined by their unique sensor domains and interaction partners. Phylogenetic analysis might reveal evolutionary relationships between DpiB and other histidine kinases, potentially providing insights into functional conservation or divergence.

What bioinformatic approaches can predict potential response regulators that partner with DpiB?

Bioinformatic prediction of DpiB's cognate response regulator involves several computational approaches. Genomic context analysis is fundamental – in bacterial genomes, histidine kinases and their partner response regulators are often encoded in the same operon or adjacently located on the chromosome. Protein-protein interaction prediction tools that analyze surface complementarity, electrostatic potential, and evolutionary conservation can identify likely interaction partners. Sequence-based approaches examining co-evolution patterns between histidine kinases and response regulators across multiple species can reveal paired signaling components. Domain architecture analysis can identify specific recognition motifs in both proteins that mediate specific interactions. Machine learning models trained on known histidine kinase-response regulator pairs can predict novel interactions based on sequence features. Structural modeling of the histidine kinase and potential response regulators followed by in silico docking analysis can evaluate physical compatibility. Network analysis integrating multiple data types (genomic context, expression patterns, protein-protein interaction data) provides a systems-level view of potential signaling relationships. Experimental validation of predicted interactions using bacterial two-hybrid assays, co-immunoprecipitation, or phosphotransfer assays remains essential to confirm computational predictions.

How can systems biology approaches integrate DpiB signaling into broader cellular response networks?

Systems biology offers powerful approaches to understand DpiB's role within broader cellular networks. Multi-omics integration combining transcriptomics, proteomics, metabolomics, and phosphoproteomics data can map the cellular changes following DpiB activation or inhibition. This approach can identify direct and indirect targets of the signaling pathway. The following table outlines a typical systems biology experimental design for studying DpiB signaling:

Experimental ConditionTranscriptomicsProteomicsPhosphoproteomicsMetabolomics
Wild-type, unstimulatedBaseline gene expressionProtein abundancePhosphorylation stateMetabolite levels
Wild-type, stimulatedChanges in gene expressionProtein changesDynamic phosphorylationMetabolic shifts
ΔdpiB, unstimulatedEffects of DpiB absenceCompensatory mechanismsBaseline without DpiBMetabolic adaptation
ΔdpiB, stimulatedGenes requiring DpiBProteins dependent on DpiBDpiB-dependent phosphorylationDpiB-dependent metabolism
DpiB overexpressionPathway saturation effectsProtein network perturbationPhosphorylation cascade amplificationMetabolic consequences

Network modeling using ordinary differential equations or Boolean networks can simulate the dynamics of DpiB signaling and predict system-level responses to perturbations. Synthetic biology approaches can rewire natural connections to test hypotheses about network architecture and information flow. Genome-scale models incorporating DpiB signaling can predict how this pathway influences broader cellular processes like metabolism and stress responses. Single-cell analyses can reveal heterogeneity in signaling responses across bacterial populations. Evolutionary systems biology comparing signaling networks across bacterial species can reveal conserved motifs and species-specific adaptations in two-component signaling architecture.

What are common pitfalls in purifying active recombinant DpiB protein and how can they be addressed?

Purifying active recombinant DpiB presents several challenges that researchers must anticipate and address. Membrane-associated histidine kinases like DpiB often show poor solubility when overexpressed, leading to inclusion body formation. This can be mitigated by reducing expression temperature (16-20°C), using weaker promoters, or employing specialized E. coli strains designed for membrane protein expression . Maintaining the native conformation during solubilization and purification requires careful selection of detergents – mild non-ionic detergents like DDM or LMNG are often preferred over harsh detergents like SDS. Protein aggregation during concentration steps can be minimized by including glycerol (10-20%) in buffers and avoiding excessive concentration. Loss of activity may occur due to removal of essential lipids during purification, which can be addressed by including E. coli lipid extracts in purification buffers or performing reconstitution into liposomes after purification. Oxidation of critical cysteine residues during purification can alter protein function, especially if DpiB contains redox-sensing cysteines similar to those in EvgS . This can be prevented by including reducing agents like DTT or β-mercaptoethanol in all buffers and handling samples under nitrogen atmosphere. Multi-domain histidine kinases may exhibit domain flexibility that complicates structural studies, which can be addressed by designing stable domain constructs or using protein engineering approaches to rigidify flexible regions.

How can researchers troubleshoot inconsistent results in DpiB activation assays?

Inconsistent results in DpiB activation assays can stem from multiple sources that require systematic troubleshooting. Variable growth conditions represent a major source of inconsistency – precise control of parameters like pH, aeration, temperature, and media composition is essential, particularly if DpiB responds to redox conditions as observed with EvgS . The growth phase of bacterial cultures significantly affects signaling system activity; standardizing the optical density at which cells are harvested helps ensure reproducibility. Genetic instability in reporter constructs can lead to variable results; maintaining selection pressure and regularly sequencing reporter constructs helps detect such issues. Sample processing times should be minimized and standardized, especially if the phosphorylation state is being measured, as histidine phosphorylation is labile. For in vitro assays, batch-to-batch variation in protein preparations can be addressed by rigorous quality control including size exclusion chromatography to ensure proper oligomeric state and activity assays to confirm functionality. Environmental factors in the laboratory (oxygen levels, temperature fluctuations) can influence redox-sensitive proteins; controlling these variables and including appropriate positive and negative controls in each experiment is crucial. Signal detection sensitivity and dynamic range limitations in reporter assays can be addressed by optimizing reporter constructs or employing more sensitive detection methods.

What strategies can overcome challenges in identifying the specific molecular signals sensed by DpiB?

Identifying the specific molecular signals sensed by DpiB requires systematic strategies to overcome significant challenges in signal identification. High-throughput screening approaches can test numerous potential stimuli, including variations in pH, osmolarity, temperature, redox conditions, and specific molecules that might bind to the sensor domain. Similar to studies with EvgS, researchers should examine DpiB activity under different respiratory conditions (aerobic, semi-aerobic, anaerobic) to determine if it functions as a redox sensor . Structural biology approaches focusing on the sensor domain can reveal binding pockets or conformational changes associated with specific ligands or conditions. Domain swapping experiments, where the sensor domain of DpiB is replaced with well-characterized sensor domains from other histidine kinases, can help identify what types of signals the native domain might detect. Genetic approaches involving random mutagenesis followed by selection for constitutively active or inactive variants can identify residues critical for signal detection. Metabolomic profiling comparing wild-type and ΔdpiB strains under different conditions might reveal accumulation or depletion of potential signaling molecules. In vitro reconstitution of the purified sensor domain with potential ligands, monitored by techniques like isothermal titration calorimetry or surface plasmon resonance, can directly measure binding interactions. Computational approaches including ligand docking simulations and molecular dynamics can predict potential binding partners and guide experimental verification.

How might single-molecule techniques advance our understanding of DpiB signaling dynamics?

Single-molecule techniques offer unprecedented resolution for studying the dynamic behavior of histidine kinases like DpiB. Single-molecule FRET (smFRET) can reveal conformational changes in individual DpiB molecules during activation, providing insights into the heterogeneity and kinetics of these transitions that are masked in ensemble measurements. This approach could directly visualize how signal detection leads to rearrangements in the protein structure. Single-molecule tracking in living bacterial cells using fluorescently tagged DpiB can reveal its spatial distribution, mobility, and potential clustering behavior in response to activating signals. These experiments could address whether histidine kinases like DpiB form signaling complexes or remain dispersed throughout the membrane. Force spectroscopy techniques such as atomic force microscopy or optical tweezers can measure the mechanical forces involved in conformational changes during signaling, providing a biophysical perspective on signal transduction. Single-molecule pull-down assays can identify transient interaction partners of DpiB that might be missed in conventional biochemical approaches. Super-resolution microscopy techniques like PALM or STORM can visualize the nanoscale organization of DpiB relative to other components of the signaling pathway in bacterial cells with unprecedented spatial resolution. Single-cell microfluidics combined with fluorescent reporters can reveal how individual bacterial cells respond to stimuli through DpiB signaling, capturing cell-to-cell variability in signaling dynamics.

What novel approaches can link DpiB function to bacterial stress responses and pathogenicity?

Novel approaches connecting DpiB function to stress responses and pathogenicity can provide important insights for antimicrobial development. Infection models using tissue cultures, invertebrates (C. elegans, Drosophila), or vertebrate systems can assess how DpiB contributes to bacterial survival and virulence during host colonization. These studies could reveal whether DpiB responds to host-derived signals or stresses encountered during infection. Synthetic biology approaches can engineer DpiB-based biosensors to monitor bacterial responses to host environments or antimicrobial compounds in real-time. CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) systems targeting dpiB or its regulon can provide tunable control over expression levels to study dosage effects on stress responses and pathogenicity. Dual RNA-seq experiments capturing simultaneous transcriptomic changes in both pathogen and host can reveal how DpiB-mediated signaling influences host-pathogen interactions. Chemical genetics approaches using small-molecule modulators of DpiB activity can probe its role in stress responses and potentially identify novel antimicrobial strategies. Evolutionary studies examining dpiB conservation and variation across pathogenic and non-pathogenic strains may reveal signatures of selection related to virulence functions. Metabolic flux analysis comparing wild-type and ΔdpiB strains during infection or stress exposure can elucidate how DpiB signaling reshapes bacterial metabolism to support survival. Multi-strain comparative genomics coupled with phenotypic profiling can identify correlations between dpiB sequence variations and differences in stress resistance or virulence traits.

How can cryo-electron microscopy and other structural approaches advance our understanding of DpiB signal transduction mechanisms?

Cryo-electron microscopy (cryo-EM) and complementary structural approaches provide powerful tools for elucidating DpiB signal transduction mechanisms. Single-particle cryo-EM can determine high-resolution structures of full-length DpiB in different functional states (inactive, active, signal-bound), overcoming challenges associated with crystallizing membrane proteins. This approach could reveal large-scale conformational changes associated with signal detection and transmission. Cryo-electron tomography of bacterial cells can visualize DpiB in its native membrane environment, potentially revealing higher-order organization and interactions with other cellular components. Time-resolved structural studies using techniques like time-resolved cryo-EM or X-ray free-electron laser crystallography can capture transient intermediates in the signaling process, providing a dynamic view of signal transduction. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map regions of DpiB that undergo changes in solvent accessibility during activation, identifying dynamic elements involved in signal transduction. Integrative structural biology approaches combining data from multiple techniques (cryo-EM, X-ray crystallography, NMR, SAXS, computational modeling) can build comprehensive models of DpiB structure and dynamics. Advanced computational approaches including molecular dynamics simulations with enhanced sampling can model large-scale conformational changes that may be challenging to capture experimentally. Structure-guided design of sensors based on DpiB could lead to the development of biosensors for environmental monitoring or diagnostic applications. The structural information gained from these approaches would not only advance our fundamental understanding of bacterial signaling but also inform structure-based drug design targeting two-component systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.