Recombinant Escherichia coli Sensor kinase CusS (cusS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
cusS; ybcZ; b0570; JW5082; Sensor histidine kinase CusS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-480
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
cusS
Target Protein Sequence
MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER VLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGAPDIREFTRDAIPDKDA QGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL RFVGDKCQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTVDHLVQVIVENPGTPIA PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDARGTRFVITLPA
Uniprot No.

Target Background

Function
CusS is a transmembrane protein and a member of the two-component regulatory system CusS/CusR in *Escherichia coli*. This system responds to copper and silver ions. CusS functions as a copper/silver ion sensor, activating CusR through phosphorylation.
Gene References Into Functions
  1. Studies investigating the roles of CusS transmembrane (TM) residues suggest that destabilization of an intramolecular constraint and subsequent rearrangement of helical interactions within this TM region are involved in CusS activation. These findings indicate a conserved transmembrane signal transduction mechanism in heavy metal-sensing two-component systems. PMID: 26844675
  2. Research demonstrates a metal-dependent mechanism for CusS activation, highlighting the essential role of CusS in Cu(I)- and Ag(I)-dependent upregulation of *cusCFBA* expression in *E. coli*. PMID: 22348296
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CusS sensor kinase and what is its primary function in E. coli?

CusS is a membrane-associated histidine kinase that functions as part of the CusSR two-component regulatory system in Escherichia coli. It serves as a Cu(I) and Ag(I)-responsive sensor kinase essential for the induction of genes encoding the CusCFBA efflux pump. This system aids in protecting cells from high concentrations of Ag(I) and Cu(I) by sensing elevated levels of these metal ions in the periplasmic space and initiating a signaling cascade that ultimately leads to metal ion efflux . The CusS protein contains a periplasmic sensor domain connected to cytoplasmic catalytic domains through two transmembrane helices, following the architecture of prototypical periplasmic sensing histidine kinases .

How does the CusSR two-component system interact with metal ions?

The CusSR two-component system consists of the membrane-bound sensor histidine kinase CusS and the cytoplasmic DNA-binding response regulator CusR. Under conditions of elevated Cu(I)/Ag(I) concentrations, CusS and CusR are essential for the induction of the copper efflux genes cusCFBA . Signal recognition occurs through direct ligand binding in the periplasmic sensor domain of CusS. Upon metal binding, CusS undergoes conformational changes that activate its kinase activity, leading to phosphorylation of CusR. The phosphorylated CusR then binds to the promoter region of the cusCFBA operon, inducing its expression and ultimately facilitating metal efflux .

What is the relationship between CusS and other copper homeostasis systems in E. coli?

In E. coli, multiple systems contribute to copper homeostasis, with CusS playing a particularly crucial role under specific conditions. While the Cue system (consisting of CopA and CueO) serves as the primary copper response system under aerobic conditions, the Cus system becomes the dominant defense mechanism under anaerobic conditions . This is because the periplasmic Cu(I) oxidase CueO cannot function in the absence of molecular oxygen, its electron acceptor . Research has shown that in a ΔcopA ΔcueO double mutant, the Cus system becomes the major remaining copper resistance system in E. coli, with deletion of cusS significantly reducing copper resistance, particularly under anaerobic conditions .

What is the structural organization of the CusS protein?

CusS is organized as a prototypical periplasmic sensing histidine kinase with distinct domains and a specific membrane topology. The protein contains a periplasmic sensor domain (approximately residues 39-187) flanked by transmembrane α-helices which connect it to conserved cytoplasmic catalytic domains . The cytoplasmic portion includes a HAMP (histidine kinase, adenylyl cyclases, methyl accepting proteins, phosphatases) domain, a dimerization and histidine phosphotransfer (DHp) domain, and a kinase core . PhoA and LacZ protein fusion experiments have verified this predicted topology, confirming that the sensor domain is indeed located in the periplasm while the amino- and large carboxy-terminal parts are cytoplasmic .

What does the crystal structure of the CusS periplasmic domain reveal about its metal-binding properties?

The crystal structure of the Ag(I)-bound periplasmic sensor domain of CusS, resolved at 2.15 Å, reveals that CusS forms a homodimer with four Ag(I) binding sites per dimeric complex . Two symmetric metal binding sites are located at the dimeric interface, each formed by two histidines and one phenylalanine with an unusual cation-π interaction. The remaining metal ion binding sites are located in non-conserved regions within each monomer . This structural arrangement suggests that metal binding enhances the tendency of the domain to dimerize, which is likely crucial for signal transduction and activation of the histidine kinase function .

What methods are effective for studying CusS membrane topology and localization?

The membrane topology and localization of CusS can be effectively studied using reporter gene fusion techniques. In particular, phoA- and lacZ-reporter gene fusions have been successfully employed to verify the periplasmic location of the sensor domain of CusS . Alkaline phosphatase (PhoA) is only active in the periplasm, while beta-galactosidase (LacZ) functions properly only in the cytoplasm. By creating fusion proteins at different positions within CusS and measuring the activities of these enzymes, researchers can determine which domains are located in the periplasm versus the cytoplasm .

For example, low alkaline phosphatase combined with high beta-galactosidase activities indicate a cytoplasmic location, while high PhoA and low LacZ enzyme activities provide evidence for a periplasmic location. This approach has confirmed that the amino- and large carboxy-terminal parts of CusS are cytoplasmic, while positions 38, 112, and 185 are periplasmic .

How can researchers effectively express and purify recombinant CusS for in vitro studies?

For in vitro studies of CusS, researchers can express the protein (or specific domains) as Strep-tagged constructs in E. coli. The periplasmic sensor domain of CusS (CusSs, residues 39-187) can be expressed and purified for analysis of its metal-binding and structural properties . For full-length CusS, expression can be controlled using inducible promoters such as those responsive to anhydrotetracycline (AHT) .

Western blotting can be used to verify the presence and localization of the expressed protein in different cellular fractions (membrane, soluble, debris). The membrane fraction containing CusS can be isolated through differential centrifugation techniques . It should be noted that overexpression may lead to some protein ending up in inclusion bodies, as observed when CusS was produced with high inducer concentrations . For structural studies, purification protocols typically involve affinity chromatography followed by size exclusion chromatography to obtain pure, homogeneous protein preparations suitable for crystallization or other biophysical analyses .

What experimental approaches can determine if CusS directly binds metal ions?

Direct metal binding to the periplasmic sensor domain of CusS can be assessed through several complementary techniques:

  • Spectroscopic methods: UV-visible spectroscopy can detect spectral changes upon metal binding, particularly for Ag(I) and Cu(I) which can form characteristic charge transfer complexes with protein ligands .

  • Isothermal titration calorimetry (ITC): This technique can measure the thermodynamic parameters of metal binding, providing information on binding affinity, stoichiometry, and the thermodynamic profile of the interaction .

  • Structural studies: X-ray crystallography of the metal-bound periplasmic domain can reveal the specific binding sites and coordination geometry, as demonstrated by the crystal structure of the Ag(I)-bound periplasmic sensor domain at 2.15 Å resolution .

  • Conformational change analysis: Techniques such as circular dichroism (CD) spectroscopy can detect conformational changes in the protein upon metal binding, supporting a mechanism of activation through structural rearrangements .

  • Mutagenesis studies: Site-directed mutagenesis of predicted metal-binding residues (particularly histidines and methionines) followed by functional or binding assays can confirm their importance in metal coordination .

How does oxygen availability affect CusS function and copper resistance in E. coli?

Oxygen availability significantly affects the importance of CusS for copper resistance in E. coli. Under anaerobic conditions, CusS plays a more critical role in copper resistance than under aerobic conditions . This differential requirement is due to the inability of the periplasmic Cu(I) oxidase CueO to function in the absence of molecular oxygen, which serves as its electron acceptor .

In quantitative terms, studies have shown that deletion of cusS in a ΔcopA ΔcueO background (where the Cus system is the major remaining copper resistance system) has a pronounced effect on copper resistance under anaerobic conditions, with significant growth inhibition observed at copper concentrations above 2 μM. Under aerobic conditions, the impact is less dramatic, with differences between the ΔcusS strain and its parent observed at much higher copper concentrations (around 250-450 μM Cu(II)) .

How does the growth medium composition influence CusS-dependent copper resistance?

Growth medium composition significantly affects CusS-dependent copper resistance in E. coli. CusS is more important for copper resistance in complex media (such as LB) than in mineral salts media (such as Tris-buffered mineral salts medium, TMM) . In LB medium under anaerobic conditions, deletion of cusS dramatically reduces copper resistance, while the effect is less pronounced in TMM .

This differential requirement may be related to the presence of organic compounds in complex media that can affect copper speciation, bioavailability, or cellular metabolism. The precise mechanisms underlying this medium-dependent effect are not fully elucidated but may involve interactions between copper ions and organic components of the media, altering the effective concentration of free copper ions that reach the periplasm and activate CusS .

What is the relationship between CusS function and osmotolerance in E. coli?

Interestingly, CusS function has been linked to osmotolerance in E. coli, suggesting broader physiological roles beyond metal resistance. A cusS mutation identified in a high-succinate-producing E. coli strain was found to improve osmotolerance . When this mutation was introduced into various E. coli strains, it led to significant increases in cell mass and product titers under high osmotic stress conditions (12-20% glucose or medium supplemented with disodium succinate) .

The mechanism appears to involve increased expression of the cusCFBA genes, as demonstrated by real-time PCR analysis showing 5.7-fold higher expression of cusS and 7.3-fold higher expression of cusC in strains carrying the cusS mutation compared to the parental strain under high glucose conditions . Deletion of cusS or cusCFBA resulted in reduced cell growth and succinate production under high glucose conditions, further supporting the relationship between CusS function and osmotolerance .

The link between copper homeostasis and osmotolerance may be explained by the observation that high osmotic stress has been associated with deleterious accumulation of Cu(I) in the periplasm. Activation of CusCFBA through CusS may alleviate this effect by transporting Cu(I) out of the cells, a hypothesis supported by experiments showing that supplementation with sulfur-containing amino acids (methionine or cysteine) that can chelate Cu(I) increased the osmotolerance of E. coli under anaerobic conditions .

What molecular events occur during CusS activation by metal ions?

The activation of CusS by metal ions involves several molecular events that transmit the signal from the periplasm to the cytoplasm:

  • Direct metal binding: The periplasmic sensor domain of CusS directly interacts with Ag(I) or Cu(I) ions through specific binding sites involving histidine and methionine residues .

  • Conformational changes: Upon metal binding, the periplasmic domain undergoes conformational changes that are likely essential for signal transduction .

  • Enhanced dimerization: Metal binding enhances the tendency of the periplasmic domain to dimerize, which may be important for the activation mechanism .

  • Transmembrane signal transduction: The signal is transmitted across the membrane through rearrangements in the transmembrane helices. This involves destabilization of intramolecular constraints between TM1 and TM2, specifically between residues T17 and V202, leading to rearrangement of helical interactions .

  • Activation of kinase activity: The conformational changes are transmitted to the cytoplasmic domains, activating the histidine kinase activity and leading to autophosphorylation of a conserved histidine residue .

  • Phosphotransfer to CusR: The phosphoryl group is transferred from CusS to an aspartate residue in the response regulator CusR .

  • Transcriptional activation: Phosphorylated CusR binds to the promoter region of the cusCFBA operon, activating transcription and leading to increased expression of the copper efflux system .

How do predicted copper-binding sites in the periplasmic domain contribute to CusS function?

The periplasmic sensor domain of CusS contains numerous histidine and methionine residues (9 and 7, respectively) that could serve as potential ligands for Cu(I) and Ag(I) . The crystal structure of the Ag(I)-bound periplasmic sensor domain has revealed four Ag(I) binding sites per dimeric complex, with two symmetric sites at the dimeric interface each formed by two histidines and one phenylalanine with an unusual cation-π interaction, and additional sites in non-conserved regions within each monomer .

The distribution and architecture of these binding sites likely play important roles in determining the metal selectivity of CusS, its sensitivity to different metal ion concentrations, and the conformational changes that occur upon metal binding. The specific coordination geometry at these sites, often involving soft Lewis bases such as histidine imidazoles and methionine thioethers, is well-suited for binding soft metal ions like Cu(I) and Ag(I) .

How does cross-talk with other two-component systems affect CusS signaling?

Cross-talk between two-component systems can potentially affect CusS signaling, although the extent and physiological relevance of such interactions remain to be fully characterized. Three histidine kinases in E. coli were reported to potentially cross-talk with Cus: BarA, UhpB, and YedV .

How can CusS mutations be exploited to improve bacterial osmotolerance in bioproduction?

The discovery that certain CusS mutations can enhance osmotolerance in E. coli provides an opportunity for biotechnological applications, particularly in the production of high-value metabolites under high-substrate or high-product conditions . A cusS mutation identified in a high-succinate-producing E. coli strain has been shown to increase cell mass and product titers under high osmotic stress conditions .

This approach can be exploited through several strategies:

  • Introduction of specific cusS mutations: The identified mutation can be introduced into production strains to improve growth and product formation under high osmotic conditions. This has been demonstrated with different strains and products, showing increases in cell mass of up to 120% and product titers of up to 492% .

  • Modulation of cusCFBA expression: Since the cusS mutation increases expression of cusCFBA genes, which appears to correlate with osmotolerance abilities, direct modulation of cusCFBA expression through promoter engineering could be an alternative approach. An artificial promoter library has been used to modulate the expression of this system, potentially offering finer control over the degree of osmotolerance enhancement .

  • Supplementation with metal-chelating compounds: The link between copper accumulation and osmotic stress suggests that supplementation with compounds that can chelate Cu(I), such as sulfur-containing amino acids (methionine or cysteine), might provide an alternative strategy to improve osmotolerance in production strains .

  • Combined strategies: For optimal results, these approaches could be combined with other osmotolerance-enhancing strategies, potentially leading to additive or synergistic improvements in strain performance under high osmotic stress conditions.

What precautions should be taken when studying recombinant CusS proteins expressed in E. coli?

When studying recombinant CusS proteins expressed in E. coli, several precautions should be taken to ensure reliable and interpretable results:

  • Be aware of E. coli contamination products: E. coli contamination products, particularly in recombinant proteins expressed in this host, can significantly affect immune responses and potentially other cellular responses in experimental systems . Transcriptome analyses have shown that E. coli contamination products can greatly affect innate and humoral immune response transcripts .

  • Consider the effects of lipopolysaccharide (LPS): LPS, a common contaminant in preparations from E. coli, can induce robust innate-like B cell and polyreactive antibody-mediated responses . This could lead to misinterpretation of experimental data, particularly in immunological studies.

  • Control expression levels: Overexpression of membrane proteins like CusS can lead to improper folding, aggregation, or inclusion body formation. Using lower inducer concentrations (e.g., 10 μg/L AHT instead of 200 μg/L) has been shown to reduce degradation and improve membrane localization of CusS derivatives .

  • Verify protein localization: It is important to verify that the expressed CusS protein is correctly localized to the membrane fraction using techniques such as western blotting of fractionated cell extracts . This is crucial for functional studies, as mislocalized protein may not reflect the native activity.

  • Validate function through complementation: To ensure that the recombinant CusS is functional, complementation experiments in ΔcusS strains can be performed, measuring restoration of copper resistance or cusCFBA expression .

  • Consider the influence of tags and fusion partners: Tags and fusion partners used for detection or purification may affect the function or localization of CusS. Control experiments comparing tagged and untagged versions, or placement of tags at different positions, may be necessary to validate results.

How do the metal-binding properties of CusS compare to other metal-sensing two-component systems in bacteria?

  • Metal selectivity: While CusS primarily responds to Cu(I) and Ag(I), other metal-sensing histidine kinases may have different selectivity profiles. For example, some may specifically sense zinc, nickel, or other transition metals. The structural basis for this selectivity often lies in the composition and arrangement of metal-binding sites.

  • Binding site architecture: The crystal structure of the Ag(I)-bound CusS periplasmic domain reveals specific features such as the unusual cation-π interaction involving phenylalanine in the metal-binding sites at the dimeric interface . Comparative structural analyses would reveal whether similar or distinct binding site architectures exist in other metal-sensing systems.

  • Sensitivity and dynamic range: Different metal-sensing systems may have evolved to respond to different concentration ranges of their target metals, reflecting their ecological niches and physiological roles. Quantitative studies of metal binding affinities and dose-response relationships for transcriptional activation would provide insights into these differences.

  • Signal transduction mechanism: The mechanism involving rearrangement of transmembrane helical interactions identified in CusS may represent a conserved feature in this class of sensors, or different systems may employ distinct signaling mechanisms. Comparative studies using techniques such as disulfide crosslinking analysis across multiple systems would be informative.

A comprehensive understanding of these similarities and differences would not only provide fundamental insights into bacterial metal sensing but could also inform the design of biosensors or regulatory circuits for biotechnological applications.

What are the current challenges in studying the dynamics of CusS activation in vivo?

Studying the dynamics of CusS activation in vivo presents several technical and conceptual challenges:

  • Real-time monitoring of conformational changes: Detecting the conformational changes that occur during CusS activation in living cells is technically challenging. Approaches such as Förster resonance energy transfer (FRET) sensors or conformation-sensitive fluorescent probes could potentially address this, but their development and validation for CusS would require significant effort.

  • Quantification of periplasmic metal concentrations: Accurately measuring the concentration of free metal ions in the periplasmic space is difficult due to its small volume and the challenge of distinguishing between different metal species (free ions versus protein-bound). Development of periplasmic-targeted metal sensors with appropriate sensitivity and selectivity would be valuable for correlating CusS activation with actual periplasmic metal levels.

  • Heterogeneity in cellular responses: Single-cell analyses have revealed that bacterial populations often exhibit heterogeneity in their responses to environmental stimuli. Understanding how individual cells within a population differ in their CusS activation dynamics and subsequent gene expression responses would require single-cell techniques for monitoring both metal sensing and transcriptional outputs.

  • Integration with other stress response systems: In vivo, CusS does not function in isolation but as part of an integrated network of stress response systems. Understanding how its activation is influenced by or influences other cellular processes, such as responses to oxidative stress, acid stress, or general envelope stress, would require systems-level approaches.

  • Temporal dynamics of the response: The kinetics of CusS activation, subsequent gene expression, and the eventual adaptation or return to baseline states represent important aspects of the system's function. Time-resolved measurements with appropriate temporal resolution would be necessary to fully characterize these dynamics.

Addressing these challenges would likely require the development and application of new methodologies at the interface of biophysics, molecular biology, and systems biology.

How might understanding CusS contribute to developing new antimicrobial strategies targeting metal homeostasis?

Understanding CusS and bacterial metal homeostasis systems could contribute to novel antimicrobial strategies in several ways:

  • Disruption of metal sensing: Compounds that specifically interfere with the metal-binding or signaling functions of CusS could potentially disrupt copper homeostasis in pathogens, sensitizing them to copper toxicity. The detailed structural information available for the CusS periplasmic domain could guide the design of such inhibitors.

  • Targeting copper homeostasis in infection: During infection, host cells often increase copper concentrations as an antimicrobial strategy. Understanding how bacteria sense and respond to this "nutritional immunity" through systems like CusS could inform approaches to enhance the effectiveness of this natural defense mechanism.

  • Combination therapies: Inhibitors of copper homeostasis systems could potentially be used in combination with conventional antibiotics or with copper-based antimicrobials to achieve synergistic effects. For example, disabling the Cus system might sensitize bacteria to both copper toxicity and antibiotics that cause membrane damage or oxidative stress.

  • Biofilm disruption: Metal homeostasis systems have been implicated in biofilm formation and maintenance. Targeting CusS or related systems might provide strategies to disrupt biofilms, which are often highly resistant to conventional antibiotics.

  • Species-selective approaches: Differences in the metal-sensing systems between different bacterial species could potentially be exploited to develop more selective antimicrobial approaches that target specific pathogens while sparing beneficial microbiota.

  • Diagnostic applications: Knowledge of CusS and related systems could also inform the development of diagnostic tools to detect specific pathogens or to monitor their physiological state during infection, potentially guiding treatment decisions.

These approaches would require detailed understanding of not only the molecular mechanisms of CusS function but also its role in the broader context of bacterial physiology and host-pathogen interactions.

What are effective approaches for studying CusS-dependent gene regulation?

Several complementary approaches can be effectively used to study CusS-dependent gene regulation:

  • Transcriptional reporter fusions: Fusing the promoter regions of CusS-regulated genes (e.g., cusCFBA) to reporter genes such as lacZ, gfp, or luciferase allows for quantitative assessment of transcriptional activity under various conditions. This approach has been used to demonstrate the copper-dependent activation of cusCFBA expression and its dependence on CusS .

  • Real-time PCR (RT-PCR): This technique allows for precise quantification of transcript levels of cusS and its target genes under different conditions. For example, RT-PCR analysis has shown that expression levels of cusS and cusC in strains with a mutated cusS were 5.7- and 7.3-fold higher, respectively, than in the parental strain under high glucose conditions .

  • Transcriptome analysis: RNA sequencing or microarray analysis can provide a genome-wide view of gene expression changes in response to conditions that activate CusS, or in mutants with altered CusS function. This approach can reveal not only the direct targets of CusS regulation but also downstream effects and potential cross-regulation with other systems .

  • Deletion and complementation analysis: Creating deletion mutants (ΔcusS) and complementing them with wild-type or mutated versions of cusS can help establish the direct role of CusS in regulating specific genes. This approach has been used to demonstrate that cusS is required for copper resistance and expression of cusCFBA .

  • Chromatin immunoprecipitation (ChIP): This technique can be used to identify the binding sites of the phosphorylated response regulator CusR on the bacterial chromosome, providing direct evidence for the genes it regulates.

  • In vitro transcription assays: Reconstituting the transcriptional regulation system in vitro with purified components (RNA polymerase, CusR, promoter DNA) can provide mechanistic insights into how phosphorylated CusR activates transcription.

How can researchers distinguish between direct and indirect effects of cusS mutations?

Distinguishing between direct and indirect effects of cusS mutations requires a multi-faceted approach:

  • Isolation of specific mutations: When studying a particular cusS mutation, it is important to ensure that other genetic changes are not present that could confound the interpretation. Whole genome sequencing of mutant strains can help identify any additional mutations that might have arisen .

  • Phenotypic reversion: Changing the mutated cusS back to its original sequence should reverse the phenotypic effects if they are directly caused by the cusS mutation. This approach has been used to demonstrate that a cusS mutation was directly responsible for improved osmotolerance, as changing it back to the original sequence led to decreased cell mass and product titer under osmotic stress .

  • Introduction of the mutation into different genetic backgrounds: Introducing the same cusS mutation into different strain backgrounds can help establish the generality of its effects and their dependence on the specific genetic context. For example, the osmotolerance-enhancing cusS mutation was introduced into different E. coli strains, consistently improving growth under high osmotic stress conditions .

  • Mechanistic studies: Investigating the molecular mechanisms by which a cusS mutation affects cellular physiology can help establish direct causal relationships. For example, demonstrating that a cusS mutation increases expression of cusCFBA, which in turn enhances copper efflux and thereby improves osmotolerance under conditions where copper accumulation is problematic, provides a mechanistic link between the mutation and the phenotype .

  • Complementation with specific variants: Complementing a ΔcusS strain with different variants of cusS (wild-type, mutation of interest, or mutations in specific functional domains) can help pinpoint which aspects of CusS function are affected by the mutation and how they relate to the observed phenotypes.

  • Correlation analysis: Examining the correlation between the degree of alteration in CusS function (e.g., level of cusCFBA expression) and the magnitude of the phenotypic effect across different mutations or conditions can provide evidence for a direct relationship.

What techniques can be used to study the dynamics of CusS-metal interactions?

Several biophysical and biochemical techniques can be employed to study the dynamics of CusS-metal interactions:

  • Isothermal titration calorimetry (ITC): This technique provides direct measurements of the thermodynamic parameters of metal binding, including binding affinity, stoichiometry, and enthalpy changes. ITC can capture the dynamics of the binding process and reveal potential cooperativity or multiple binding sites with different affinities .

  • Fluorescence spectroscopy: If CusS contains or is engineered to contain fluorescent residues (e.g., tryptophan) near metal-binding sites, changes in fluorescence upon metal binding can provide information on the kinetics and dynamics of the interaction. Alternatively, fluorescent metal chelators can be used in competition assays.

  • Circular dichroism (CD) spectroscopy: This technique can detect conformational changes in protein secondary structure upon metal binding, providing insights into the structural dynamics associated with CusS activation .

  • Surface plasmon resonance (SPR): SPR can measure the kinetics of metal binding to immobilized CusS (or its periplasmic domain), providing rate constants for association and dissociation.

  • Nuclear magnetic resonance (NMR) spectroscopy: For smaller domains of CusS, NMR can provide atomic-level information on the dynamics of metal binding, including identification of the amino acids involved in coordination and detection of conformational changes.

  • X-ray absorption spectroscopy (XAS): Techniques such as XANES (X-ray absorption near edge structure) and EXAFS (extended X-ray absorption fine structure) can provide detailed information on the coordination environment of the metal ions bound to CusS, including coordination number, types of ligands, and bond distances.

  • Time-resolved crystallography: By capturing crystal structures of CusS at different time points after metal addition, the structural transitions associated with metal binding and signal transduction could potentially be mapped.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of CusS that undergo changes in solvent accessibility or hydrogen bonding upon metal binding, providing insights into the conformational dynamics of the protein.

These techniques, used in combination, can provide a comprehensive understanding of the dynamics of CusS-metal interactions from initial binding through conformational changes to signal transduction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.