Recombinant Escherichia coli Sensor protein BasS (basS)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Escherichia coli Sensor Protein BasS

The BasS protein is a sensor histidine kinase that is part of the BasS-BasR two-component system (TCS) in Escherichia coli. The BasS-BasR system functions as a transcriptional regulator that responds to iron and zinc levels . Two-component systems like BasS/BasR are signal transduction pathways widely used by prokaryotic and eukaryotic organisms . Typically, TCS involves a sensor that monitors external signals and a response regulator (RR) that controls gene expression and other physiological activities .

Function and Regulation

BasS is an inner membrane protein that senses environmental signals, leading to autophosphorylation of a conserved histidine residue . This phosphoryl group is then transferred to a specific aspartate residue on its cognate response regulator, BasR, activating it . Once activated, BasR regulates the transcription of genes involved in various stress responses and adaptations .

Role in Metal Homeostasis

The BasS-BasR system is known for its role as an iron- and zinc-sensing transcription regulator in E. coli . Genomic SELEX screening has identified numerous binding sites of phosphorylated BasR on the E. coli genome, predicting many novel targets of regulation . A direct repeat of a TTAAnnTT sequence was identified as the BasR box through DNase I footprint analysis for high-affinity BasR-binding sites .

Impact on Sensitivity to Plantaricin BM-1

Studies have explored the role of the BasS/BasR TCS in E. coli K12's response to plantaricin BM-1, an antibacterial substance . Disruptions in the BasS/BasR TCS can increase the sensitivity of E. coli K12 to plantaricin BM-1 . Proteomic analysis has revealed that mutations in basS and basR affect the synthesis and metabolism of various substances in E. coli, including amino acids and enzymes involved in cellular activities .

Identification of Novel Regulation Targets

Research utilizing Genomic SELEX screening has identified at least 38 binding sites of phosphorylated BasR on the E. coli genome, suggesting more than 20 novel targets of regulation . Further analysis using DNase I footprinting identified a direct repeat of a TTAAnnTT sequence as the BasR box .

Expression Analysis

*Genome-wide transcriptional profiling of E. coli has shown that basS exhibits high expression levels under certain conditions . In one study, basS showed the highest expression (induction ratio, 15.7) among all induced genes .

Data Table: Proteomic Analysis of E. coli Mutants

Proteomic analysis was performed on E. coli K12, E. coli JW4073 (basS mutant), and E. coli JW4074 (basR mutant) to determine how the BasS/BasR TCS affects the sensitivity of E. coli K12 to Plantaricin BM-1 . A total of 2,752 proteins were identified . Differential expression was defined as a 1.2-fold change in threshold (upregulated Fold change >1.2, downregulated Fold change <0.83), and a Student’s t-test P-value < 0.05 .

StrainUpregulated ProteinsDownregulated Proteins
E. coli JW407310062
E. coli JW40742658

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
basS; pmrB; b4112; JW4073; Sensor protein BasS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
basS
Target Protein Sequence
MHFLRRPISLRQRLILTIGAILLVFELISVFWLWHESTEQIQLFEQALRDNRNNDRHIMR EIREAVASLIVPGVFMVSLTLFICYQAVRRITRPLAELQKELEARTADNLTPIAIHSATL EIEAVVSALNDLVSRLTSTLDNERLFTADVAHELRTPLAGVRLHLELLAKTHHIDVAPLV ARLDQMMESVSQLLQLARAGQSFSSGNYQHVKLLEDVILPSYDELSTMLDQRQQTLLLPE SAADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQEDDGAVMAVEDEGPGIDESK CGELSKAFVRMDSRYGGIGLGLSIVSRITQLHHGQFFLQNRQETSGTRAWVRLKKDQYVA NQI
Uniprot No.

Target Background

Function
Recombinant *Escherichia coli* Sensor protein BasS (basS) is a member of the two-component regulatory system BasS/BasR. It autophosphorylates and activates BasR through phosphorylation.
Gene References Into Functions
  1. A study identified the pmrB gene as a primary chromosomal target for the induction of colistin and polymyxin B resistance in *E. coli*. PMID: 29091192
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the BasS/BasR two-component system in E. coli?

The BasS/BasR is a histidine-aspartate phosphorelay signal transduction system in Escherichia coli that functions as an iron- and zinc-sensing transcription regulator. This two-component system (TCS) directly regulates genes associated with metal-response-mediated membrane structure modification and the modulation of membrane functions, as well as genes associated with response to acidic and/or anaerobic growth conditions .

In E. coli K12, the BasS/BasR TCS is also involved in the bacterial response to antimicrobial peptides such as plantaricin BM-1, as evidenced by proteomics analysis showing significantly increased expression of this system (P < 0.05) when exposed to this bacteriocin . Additionally, the BasS/BasR TCS can induce the upregulation of genes related to biofilm formation in Avian pathogenic E. coli (APEC) .

How does mutation in the BasS gene affect bacterial sensitivity to antimicrobial compounds?

Research has demonstrated that mutations in the BasS/BasR TCS significantly impact E. coli's sensitivity to antimicrobial compounds. Growth curve experiments with plantaricin BM-1 revealed the following IC50 values:

StrainIC50 Value (mg/mL)
E. coli K12 (wild type)10.85
basS mutant (E. coli JW4073)8.94
basR mutant (E. coli JW4074)7.62

These findings indicate that mutations in either BasS or BasR lead to increased sensitivity to plantaricin BM-1, with the BasR mutation having a more pronounced effect . This suggests the BasS/BasR TCS plays a critical role in antimicrobial resistance mechanisms in E. coli.

Which downstream proteins are regulated by the BasS/BasR two-component system?

Proteomics and RT-qPCR analyses have identified several downstream proteins regulated by the BasS/BasR TCS that are involved in cell membrane structure and function, including:

  • DgkA (diacylglycerol kinase)

  • FliC (flagellin)

  • MlaE (membrane lipid asymmetry maintenance protein)

Additionally, the system regulates genes associated with:

  • Outer membrane proteins

  • Integral components of the plasma membrane

  • Cell motility regulation

  • Locomotion regulation

What are the most effective methods for recombinant expression of BasS protein in E. coli?

For recombinant expression of membrane-associated sensor proteins like BasS in E. coli, several expression systems have proven effective:

T7 Promoter System (pET vectors)

The T7 promoter system is extremely popular and can represent up to 50% of the total cell protein in successful cases . The system includes:

  • Plasmids with pMB1 origin (medium copy number)

  • Gene of interest cloned behind a T7 promoter recognized by T7 RNA polymerase

  • T7 RNA polymerase usually provided in a prophage (λDE3) under IPTG-inducible control

  • T7 lysozyme for polymerase inhibition to control basal expression

Arabinose-Inducible System (pBAD vectors)

The pBAD vectors utilize positive control through the araPBAD promoter, offering lower background expression:

  • AraC protein functions as both repressor and activator

  • In the absence of arabinose, AraC represses translation

  • Upon arabinose addition, AraC switches to "activation mode"

Expression Optimization Table

ParameterOptimal ConditionNotes
Growth mediumAuto-inducible medium (ZYM-5052) or LBBoth yield comparable protein expression/solubility profiles
Inoculation methodDirect transformation mixSaves time and circumvents error-prone colony picking
Cell density<1 × 10^10 cells/mlUpper limit in standard conditions
TemperatureLower than 37°C for membrane proteinsReduces inclusion body formation

How does the BasS/BasR system contribute to the tricarboxylic acid cycle regulation?

Recent research has revealed that the BasS/BasR TCS affects the sensitivity of E. coli to antimicrobial compounds by regulating the tricarboxylic acid (TCA) cycle . When the BasS/BasR system is activated:

  • It modulates metabolic pathways including:

    • Outer membrane protein expression

    • Glycine betaine transport

    • Amino-acid betaine transport

    • Transmembrane signaling receptor activity

  • The system influences energy metabolism through TCA cycle regulation, which may alter:

    • ATP production

    • Redox balance

    • Biosynthetic precursor availability

These metabolic alterations contribute to the bacterial adaptive response against antimicrobial compounds, as evidenced by the increased sensitivity observed in BasS/BasR mutants.

What techniques can be used to study the structural features of the BasS sensor protein?

Understanding the structural features of sensor proteins like BasS requires sophisticated techniques:

Cryo-Electron Microscopy

Recent advances in cryo-EM have enabled high-resolution reconstructions of membrane proteins, revealing:

  • Gating mechanisms

  • Sensor domains

  • Conformational changes upon activation

For example, similar approaches were used to determine the structure of the pH sensing ion channel TASK2, revealing two distinct gates for sensing intracellular and extracellular pH .

Protein Design and Computational Modeling

  • AI-generated protein design approaches, like those developed by Nobel laureate David Baker's team, can be adapted to study sensor protein structures

  • These computational methods generate proteins with repeating subunits surrounding a central cavity where small molecules bind

  • Such approaches could help understand BasS binding to metal ions

Molecular Dynamics Simulations

These can reveal how substrates bind to transporters and sensor proteins:

  • For instance, in BASS transporters (Bile Acid Sodium Symporter family), two helices cross over in the center in an arrangement held together by sodium ions

  • Simulations showed that substrates bind between the N-termini of opposing helices in this cross-over region

  • The binding remains stable when sodium ions are present but becomes more mobile in their absence

How can mutations in the BasS/BasR system be designed to study functional domains?

To investigate functional domains of the BasS/BasR system, several methodological approaches have been developed:

Site-Directed Mutagenesis

Target-specific amino acid residues that are predicted to be involved in:

  • Metal ion sensing

  • Phosphorylation

  • Signal transduction

  • Protein-protein interaction with BasR

What expression systems beyond E. coli have been successful for membrane sensor protein production?

While E. coli remains the most common expression system for recombinant proteins, other systems offer advantages for membrane-associated sensor proteins:

Insect Cell Expression Systems

Sf9 cells (derived from Spodoptera frugiperda) provide:

Mammalian Expression Systems

Chinese Hamster Ovary (CHO) cells offer:

  • More complex glycosylation patterns

  • Higher in vivo stability of recombinant proteins

  • Better membrane protein folding

  • Lower protein yields compared to insect cells

Comparative analysis of recombinant proteins expressed in different systems:

ParameterInsect Cells (Sf9)Mammalian Cells (CHO)E. coli
YieldHighModerateHighest
GlycosylationSimple eukaryoticComplex eukaryoticNone
In vivo stabilityModerateHighLow
Folding efficiency for membrane proteinsGoodBestLimited
Production time1-2 weeks3-6 weeks1-3 days
CostModerateHighLow

How can proteomics approaches be used to identify BasS/BasR regulated pathways?

Proteomics analysis has been instrumental in identifying pathways regulated by the BasS/BasR system. In a study examining E. coli K12 response to plantaricin BM-1:

  • A total of 323 proteins showed differential expression (P < 0.05)

  • 118 proteins were downregulated

  • 205 proteins were upregulated

Upregulated Pathways:

  • Outer membrane proteins

  • Integral components of plasma membrane

  • Regulation of cell motility

  • Regulation of locomotion

Downregulated Pathways:

  • Outer membrane protein glycine betaine transport

  • Amino-acid betaine transport

  • Transmembrane signaling receptor activity

To apply similar approaches to identify BasS/BasR regulated pathways:

  • Perform comparative proteomics between wild-type and basS/basR mutant strains under various stress conditions

  • Use mass spectrometry-based techniques (LC-MS/MS)

  • Apply statistical analysis to identify significantly altered proteins

  • Perform pathway enrichment analysis to identify affected cellular processes

  • Validate key findings with targeted approaches (Western blot, RT-qPCR)

How can I design experiments to study BasS interaction with specific metals?

To investigate BasS interactions with metals such as iron and zinc:

Metal Binding Assays

  • Express and purify recombinant BasS protein using affinity tags

  • Perform isothermal titration calorimetry (ITC) to measure binding affinities

  • Use circular dichroism (CD) spectroscopy to detect conformational changes upon metal binding

  • Apply microscale thermophoresis (MST) to measure binding constants

In Vivo Metal Response Systems

Design reporter systems using:

  • BasS/BasR-regulated promoters fused to fluorescent proteins or luciferase

  • Express in wild-type and basS mutant backgrounds

  • Expose to varying concentrations of metals (Fe²⁺, Zn²⁺)

  • Measure reporter activity in real-time

Site-Directed Mutagenesis Approach

  • Identify potential metal-binding residues through sequence alignment and structural prediction

  • Create single and multiple mutants of these residues

  • Test metal binding capacity and downstream signaling of each mutant

  • Compare to wild-type BasS response

What controls should be included when studying BasS/BasR-mediated gene regulation?

Proper experimental controls are crucial for studying BasS/BasR-regulated genes:

Genetic Controls

  • Wild-type E. coli K12

  • basS mutant strain (e.g., E. coli JW4073)

  • basR mutant strain (e.g., E. coli JW4074)

  • Complemented strains (E. coli ReJW4073 and E. coli ReJW4074)

  • Mutants with constitutively active BasS

Environmental Controls

  • Metal-depleted media (using chelators like EDTA)

  • Media supplemented with specific concentrations of Fe²⁺, Zn²⁺

  • pH-controlled media (for acidic response testing)

  • Aerobic vs. anaerobic conditions

Molecular Controls

  • Non-BasS/BasR regulated promoters

  • Constitutive promoters (e.g., sigma70-dependent)

  • Promoters regulated by other two-component systems

How can I differentiate between direct and indirect effects of BasS/BasR regulation?

Distinguishing direct from indirect BasS/BasR regulatory effects requires targeted experimental approaches:

Chromatin Immunoprecipitation (ChIP)

  • Express epitope-tagged BasR in appropriate strains

  • Perform ChIP followed by sequencing (ChIP-seq) or qPCR

  • Identify genomic regions directly bound by BasR

  • Compare with gene expression data to differentiate direct vs. indirect regulation

Electrophoretic Mobility Shift Assays (EMSA)

  • Express and purify recombinant BasR

  • Phosphorylate BasR in vitro using purified BasS or chemical phosphorylation

  • Incubate with labeled DNA fragments from putative target promoters

  • Analyze mobility shifts to confirm direct binding

Time-Course Experiments

  • Induce BasS/BasR system with appropriate stimuli

  • Collect samples at multiple time points (minutes to hours)

  • Perform RNA-seq or qPCR for target genes

  • Early-responding genes are more likely direct targets

How should I analyze transcriptomic data to identify BasS/BasR regulon members?

Analyzing transcriptomic data to identify BasS/BasR regulon members requires a systematic approach:

Differential Expression Analysis

  • Compare RNA-seq data between wild-type and basS/basR mutant strains

  • Use statistical packages (e.g., DESeq2, edgeR) to identify differentially expressed genes

  • Apply appropriate cutoffs (typically |log₂FC| > 1 and adjusted p-value < 0.05)

Motif Analysis

  • Extract promoter regions of differentially expressed genes

  • Use motif discovery tools (MEME, HOMER) to identify enriched sequence motifs

  • Compare with known or predicted BasR binding sites

Validation Strategy

  • Select 5-10 genes with varying degrees of differential expression

  • Perform RT-qPCR validation

  • Create transcriptional fusions with reporter genes

  • Test response to BasS/BasR activation in wild-type vs. mutant strains

What statistical approaches are appropriate for analyzing BasS/BasR phosphorylation kinetics?

Phosphorylation kinetics of two-component systems require specific statistical approaches:

Reaction Kinetics Models

  • Apply Michaelis-Menten kinetics to analyze initial rates

  • Use non-linear regression to fit experimental data to kinetic models

  • Extract parameters like Km and Vmax for wild-type and mutant BasS

Time-Series Analysis

  • Collect phosphorylation data at multiple time points

  • Apply polynomial regression or spline fitting

  • Compare curves between different experimental conditions

  • Use area under curve (AUC) measurements for statistical comparisons

Multiple Testing Correction

When comparing multiple conditions or time points:

  • Apply correction methods (Bonferroni, Benjamini-Hochberg)

  • Report adjusted p-values

  • Consider false discovery rate (FDR) approach for large-scale comparisons

How can I resolve contradictory findings regarding BasS/BasR regulation of specific genes?

Contradictory findings about BasS/BasR regulation can arise from experimental variables. To resolve these:

Systematic Review Approach

  • Compare experimental conditions across studies:

    • Bacterial strains and genetic backgrounds

    • Growth conditions (media, temperature, aeration)

    • Induction methods and concentrations

    • Time points analyzed

  • Consider posttranscriptional effects:

    • Check if mRNA levels correlate with protein levels

    • Investigate potential small RNA regulation

    • Examine protein stability differences

  • Evaluate context-dependent regulation:

    • Test if BasS/BasR effects depend on other regulatory systems

    • Examine potential cross-talk with other two-component systems

    • Investigate condition-specific effects (e.g., growth phase, stress)

  • Perform definitive validation experiments:

    • Direct binding assays (ChIP-seq, EMSA)

    • Mutagenesis of putative binding sites

    • Reporter assays in multiple conditions

What are the main obstacles in purifying functional recombinant BasS protein?

Purifying functional membrane-associated sensor proteins like BasS presents several challenges:

Solubility Issues

Membrane proteins often form inclusion bodies when overexpressed:

  • Lower expression temperature (16-25°C)

  • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

  • Try codon-optimized sequences for reduced translation rates

  • Screen multiple detergents for solubilization

Maintaining Native Conformation

  • Avoid harsh denaturants if possible

  • Use mild detergents (DDM, LMNG) or amphipols

  • Consider nanodiscs or liposome reconstitution

  • Validate functionality with in vitro phosphorylation assays

Purification Strategy

For BasS purification, a recommended approach includes:

  • Express with C-terminal His₆ tag in E. coli C43(DE3) strain

  • Solubilize membranes with 1% DDM

  • Purify using Ni-NTA affinity chromatography

  • Apply size exclusion chromatography in 0.05% DDM

  • Validate structure using circular dichroism spectroscopy

How can I troubleshoot failed BasS/BasR complementation experiments?

When BasS/BasR complementation experiments fail, systematic troubleshooting is required:

Common Issues and Solutions

IssueDiagnostic ApproachSolution
Low expressionWestern blot or qPCROptimize promoter strength or ribosome binding site
Unstable proteinPulse-chase analysisAdd protease inhibitors or use protease-deficient strains
Improper foldingCircular dichroism analysisExpress at lower temperature or with chaperones
Missing cofactorsMetal analysis by ICP-MSSupplement media with required metals
Incorrect localizationFractionation and immunoblottingAdd proper signal sequences or membrane targeting domains

Verification Experiments

  • Confirm complementation construct sequence

  • Verify expression by Western blot or RT-qPCR

  • Test functionality with known BasS/BasR-dependent phenotypes

  • Consider expressing a tagged version to track localization

What new technologies could advance our understanding of BasS/BasR signaling?

Emerging technologies offer new ways to study BasS/BasR signaling:

CRISPR Interference (CRISPRi)

  • Allows precise, tunable repression of BasS/BasR expression

  • Can target specific domains within genes

  • Enables temporal control of gene expression

  • Useful for studying essential genes where knockouts are lethal

Microfluidic Single-Cell Analysis

  • Monitors BasS/BasR activation at single-cell level

  • Reveals heterogeneity in bacterial populations

  • Allows real-time tracking of signaling dynamics

  • Can correlate with other cellular parameters

In Situ Structural Biology

  • Cryo-electron tomography to visualize BasS in native membrane environment

  • Correlative light and electron microscopy (CLEM) to connect function with structure

  • Super-resolution microscopy to track BasS/BasR localization and clustering

Computational Approaches

Advances in artificial intelligence, like those used by David Baker's lab for protein design , could help predict:

  • BasS structural changes upon activation

  • Optimal binding interfaces

  • Effects of mutations on signaling efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.