Recombinant Escherichia coli Sensor protein PhoQ (phoQ)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
phoQ; b1129; JW1115; Sensor protein PhoQ; Sensor histidine protein kinase/phosphatase PhoQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
phoQ
Target Protein Sequence
MKKLLRLFFPLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFY
TLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFH
EIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDT
IPVELKSSYMVWSWFIYVLSANLLLVIPLLWVAAWWSLRPIEALAKEVRELEEHNRELLN
PATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSV
SDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGV
NISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGI
PLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH
SAPKDE
Uniprot No.
Target Background
Function
PhoQ is a transmembrane protein kinase, a component of the two-component regulatory system PhoP/PhoQ in *Escherichia coli*. This system governs adaptation to low Mg2+ environments and regulates acid resistance genes. Under low periplasmic Mg2+ conditions, PhoQ autophosphorylates and transfers the phosphate group to PhoP, activating PhoP-activated genes (PAGs) and repressing PhoP-repressed genes (PRGs). Conversely, under high periplasmic Mg2+ conditions, PhoQ acts as a phosphatase, dephosphorylating PhoP, thus repressing PAGs and potentially activating some PRGs. PhoP-regulated transcription displays redox sensitivity, being upregulated under more reducing periplasmic conditions (e.g., *dsbA/dsbB* deletion or dithiothreitol treatment). MgrB mediates the interaction between DsbA/DsbB and PhoP/PhoQ, requiring its two periplasmic cysteine residues for its influence on PhoQ and subsequent PhoP activity. PhoQ, through PhoP, mediates magnesium influx via *mgtA* activation and promotes expression of the *rstA/rstB* two-component system, along with the *hemL*, *mgrB*, *nagA*, *slyB*, *vboR*, and *yrbL* genes.
Gene References Into Functions
- Analysis reveals that PhoQ kinase function relies on the polarity of Asn202, independent of its precise structural position within the transmembrane region. PMID: 20404199
- X-ray crystallography elucidated the functional dimer structure of the PhoQ sensor domain. PMID: 18348979
Database Links
KEGG: ecj:JW1115
STRING: 316385.ECDH10B_1201
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
