Recombinant Escherichia coli Sensor protein qseC (qseC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
qseC; ygiY; b3026; JW2994; Sensor protein QseC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
qseC
Target Protein Sequence
MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL NEINAADRMAQTPNRLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG QLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPIMLIIMMV LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHSIKRTGQPLLLSLLVRNL LDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS IVQRIAKLHGMNVEFGNAEQGGFEAKVSW
Uniprot No.

Target Background

Function
QseC is a member of the two-component regulatory system QseB/QseC. It activates the flagella regulon by upregulating FlhDC transcription and may activate QseB through phosphorylation.
Gene References Into Functions
  1. Structural study of the cytoplasmic domain of QseC (QseC-CD) using X-ray crystallography. PMID: 20594156
  2. QseC functions as a bacterial adrenergic receptor, activating virulence genes in response to inter-kingdom cross-signaling. PMID: 16803956
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is QseC and what is its primary function in bacteria?

QseC is a sensor kinase that functions as a bacterial adrenergic receptor, specifically sensing both bacterial autoinducer-3 (AI-3) signals and host hormones epinephrine/norepinephrine. In enterohemorrhagic E. coli O157:H7, QseC plays a crucial role in activating transcription of virulence genes in response to these signals . Mechanistically, QseC initiates a phosphorylation cascade upon sensing these molecules, ultimately resulting in altered gene expression that promotes bacterial virulence and colonization. The protein adopts an inside-out orientation in the bacterial membrane, with the periplasmic signal-recognition domain sensing environmental signals and the cytoplasmic kinase domain initiating downstream signaling .

How is QseC involved in interkingdom signaling?

QseC serves as a bacterial receptor that recognizes both bacterial AI-3 and mammalian stress hormones (epinephrine/norepinephrine), enabling bacteria to detect and respond to signals from both their microbial community and their host environment . This dual-sensing capability represents a form of interkingdom cross-signaling, where bacteria can "eavesdrop" on host signaling to regulate their virulence. In experimental settings, QseC has been demonstrated to directly bind these signals, and this binding can be specifically blocked by the α-adrenergic antagonist phentolamine . This cross-kingdom signaling mechanism likely evolved to allow bacteria to recognize when they are within a host environment, thus triggering appropriate virulence programs.

How conserved is the QseC sensor protein across bacterial species?

In silico analysis of the periplasmic (signal-sensing) domain of QseC reveals a high degree of conservation among different bacterial species . The QseC sensor has been identified in multiple bacterial genera including Shigella, Salmonella, Erwinia carotovora, Haemophilus influenzae, Pasteurella multocida, Actinobacillus pleuropneumoniae, Chromobacterium violaceium, Rubrivivax gelatinosus, Thiobacillus denitrificans, Ralstonia eutropa, Ralstonia metallidurans, and Psychrobacter species . Interestingly, homology has also been identified to a fungal protein of unknown function from Aspergillus nidulans, suggesting a potentially ancient evolutionary history for this signaling mechanism .

What evidence demonstrates QseC's role in bacterial virulence?

The role of QseC in bacterial pathogenesis has been experimentally demonstrated through several approaches:

  • Gene expression studies showing that a qseC mutant does not activate expression of flagella and motility genes in response to AI-3, epinephrine, or norepinephrine

  • In vivo virulence studies using a rabbit animal model that demonstrated a qseC mutant is attenuated for virulence, providing direct evidence of its importance in pathogenesis

  • Molecular studies showing QseC autophosphorylation in response to both bacterial AI-3 and mammalian stress hormones, with this response being specifically blocked by adrenergic antagonists

These multiple lines of evidence from different experimental approaches strongly support QseC's critical role in bacterial virulence mechanisms.

What methodological approaches are recommended for studying QseC function in recombinant systems?

To effectively study QseC function in recombinant systems, researchers should consider a multi-faceted experimental approach:

  • Protein Expression and Purification: Express Myc-His-tagged QseC under native conditions to preserve protein structure and function. Membrane proteins like QseC require specialized purification approaches to maintain their integrity .

  • Liposome Reconstitution: Reconstitute purified QseC into liposomes to study signal transduction and transmembrane signaling. This system is particularly useful because it maintains the membrane-intrinsic portions of the protein that link the periplasmic sensory and cytoplasmic kinase domains .

  • Orientation Verification: Confirm the orientation of QseC in liposomes using Western blot analysis with anti-Myc antibody, which can detect the Myc-tag without disrupting the liposomes, confirming the inside-out orientation .

  • Autophosphorylation Assays: Perform in vitro autophosphorylation assays to assess QseC functionality and response to different signals, including AI-3 and epinephrine/norepinephrine .

  • Signal Antagonist Studies: Include α-adrenergic antagonists such as phentolamine to verify signal specificity and blocking effects .

These methodological approaches provide a comprehensive strategy for investigating QseC function in controlled recombinant systems.

How can researchers address potential contradictions in QseC experimental data?

When encountering contradictory data in QseC research, scientists should adopt a methodical approach to resolve inconsistencies:

  • Embrace the Contradiction: Rather than dismissing contradictory findings, researchers should view them as opportunities for discovery. As noted in experimental studies of cognitive bias, contradictions often lead to new insights and predictions that can profoundly alter the course of a project .

  • Control for Confirmation Bias: Be aware that preconceived expectations can influence data interpretation. Studies have shown that individuals with different expectations examining the same data may report detecting different patterns . When studying QseC signaling, especially in complex datasets, consciously control for such biases.

  • Systematically Vary Experimental Conditions: Test QseC functioning under different environmental conditions that might reveal context-dependent behavior, such as varying pH, temperature, or ionic strength, which might explain apparent contradictions.

  • Implement Multiple Analytical Approaches: As demonstrated in functional magnetic resonance imaging studies, different analysis workflows can lead to contradictory interpretations of the same dataset . Apply multiple analytical techniques to QseC experimental data to determine whether contradictions are methodological artifacts.

  • Cross-validate with Independent Methods: Confirm key findings through orthogonal experimental approaches (e.g., both biochemical and genetic methods) to strengthen confidence in results.

This systematic approach helps researchers navigate contradictions and can potentially lead to novel insights about QseC functioning.

What are the considerations for designing quasi-experimental approaches to study QseC in complex host-pathogen systems?

When true experimental designs are impractical or unethical for studying QseC in complex host-pathogen systems, quasi-experimental approaches offer viable alternatives:

Table 1: Comparison of Experimental Approaches for QseC Research

ApproachAdvantagesLimitationsRecommended Application
True ExperimentalHigh internal validity; Clear causalityMay be unethical or impractical in complex systemsControlled in vitro studies of purified QseC
Quasi-ExperimentalHigher external validity; More realistic conditionsLower internal validity; Cannot fully control confounding variablesNatural infection models; Complex tissue systems
Non-Experimental ObservationalStudies natural phenomena without interventionLimited ability to establish causalityPreliminary studies; Hypothesis generation

When designing quasi-experimental studies for QseC research:

  • Carefully Select Comparison Groups: Since random assignment is not possible, select groups with similar baseline characteristics to reduce confounding factors .

  • Implement Pre-test/Post-test Designs: Measure outcomes before and after experimental intervention to account for pre-existing differences .

  • Consider Interrupted Time Series Designs: These can be valuable for studying QseC's role in infection dynamics over time, capturing temporal patterns that might be missed in cross-sectional studies .

  • Control for Known Confounders: Statistically control for variables known to affect QseC signaling or bacterial virulence .

  • Acknowledge Limitations: Clearly state the limitations of quasi-experimental designs, particularly regarding causal inferences about QseC function .

Quasi-experimental approaches are particularly valuable for studying QseC in complex host-pathogen interactions where controlled laboratory manipulations might not capture the full complexity of natural systems .

How can researchers optimally design recombinant QseC constructs for functional studies?

Designing optimal recombinant QseC constructs requires careful consideration of protein structure-function relationships:

  • Domain Preservation: Ensure that both the periplasmic signal-sensing domain and the cytoplasmic kinase domain remain intact, as they are essential for signal detection and downstream phosphorylation events respectively .

  • Membrane-spanning Regions: Preserve the membrane-intrinsic portions that link the periplasmic sensory and cytoplasmic kinase domains, as these are crucial for transmembrane signaling .

  • Affinity Tags Placement: Add affinity tags (such as Myc-His) in positions that do not interfere with protein folding or function. C-terminal tags are often preferred as they are less likely to disrupt signal peptide processing and protein folding .

  • Expression Systems: Select expression systems that can properly fold membrane proteins and incorporate them into membranes. For QseC, which has multiple transmembrane domains, specialized expression systems may be necessary.

  • Functional Validation: Validate the functionality of recombinant constructs through autophosphorylation assays before proceeding to more complex experiments .

Each of these design considerations directly affects the integrity and functionality of recombinant QseC proteins in experimental systems.

What controls are essential when studying QseC signaling in experimental systems?

Rigorous experimental design for QseC research requires multiple types of controls:

  • Negative Controls:

    • Liposomes without QseC to establish baseline phosphorylation levels

    • QseC mutants with alterations in the signal-sensing domain to verify specificity

    • Vehicle controls (solvents used for signal molecules) to rule out non-specific effects

  • Positive Controls:

    • Known inducers of QseC signaling (e.g., established concentrations of epinephrine/norepinephrine)

    • Alternative sensor kinases with established activation patterns

  • Specificity Controls:

    • Competitive inhibition with α-adrenergic antagonists like phentolamine

    • Structural analogs of signal molecules to test receptor specificity

  • System Validation Controls:

    • Western blot confirmation of QseC incorporation into liposomes

    • Verification of QseC orientation in membrane systems

  • Technical Replication: Multiple technical replicates to account for assay variability

  • Biological Replication: Multiple biological replicates using independently prepared protein samples

Implementing these controls ensures that observed effects are specific to QseC signaling rather than experimental artifacts.

How can researchers evaluate data quality and manage contradictions in QseC research?

Evaluating data quality and managing contradictions in QseC research requires systematic approaches:

  • Statistical Robustness Assessment:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple statistical approaches to confirm findings

    • Consider Bayesian approaches for complex datasets

  • Contradiction Analysis Framework:

    • When contradictory results emerge, systematically evaluate:
      a) Technical variables (reagent quality, instrument calibration)
      b) Biological variables (strain variations, growth conditions)
      c) Analytical differences (data processing methods)
      d) Theoretical framework assumptions

  • Multi-investigator Validation: Have multiple researchers independently analyze the same data to identify potential confirmation biases .

  • Cross-methodology Verification: Verify key findings using complementary experimental approaches (e.g., genetic, biochemical, and structural approaches).

  • Open Data Practices: Maintain complete datasets including "outliers" that might initially appear contradictory but could contain valuable information .

As highlighted in studies of scientific cognition, contradictions in data can be valuable catalysts for discovery when properly analyzed rather than dismissed . The systematic evaluation of contradictions in QseC research may lead to deeper insights about context-dependent signaling or previously unrecognized regulatory mechanisms.

What are the recommended approaches for studying QseC interactions with host hormones?

To effectively study QseC interactions with host hormones, researchers should implement the following approaches:

  • Direct Binding Assays:

    • Use purified QseC reconstituted into liposomes for in vitro binding studies with labeled hormones

    • Implement surface plasmon resonance or other label-free technologies to measure binding kinetics

    • Determine binding affinities for different catecholamines (epinephrine vs. norepinephrine)

  • Competitive Binding Studies:

    • Use α-adrenergic antagonists like phentolamine to assess binding specificity

    • Compare binding profiles with various structural analogs to map binding site requirements

  • Structural Biology Approaches:

    • Implement cryo-EM or X-ray crystallography to determine QseC structure in hormone-bound state

    • Use computational modeling to predict hormone binding sites for subsequent experimental validation

  • Mutational Analysis:

    • Generate site-directed mutants in predicted hormone-binding regions

    • Assess impact on signaling response and pathogenesis in both in vitro and in vivo systems

  • Physiologically Relevant Conditions:

    • Test hormone concentrations that reflect those found in the gastrointestinal tract during infection

    • Consider hormone dynamics in response to host stress during infection

These approaches collectively provide a comprehensive framework for understanding the molecular basis and physiological significance of QseC-hormone interactions.

How can systems biology approaches enhance understanding of QseC signaling networks?

Systems biology offers powerful approaches to comprehensively understand QseC signaling networks:

  • Transcriptomic Profiling:

    • Compare gene expression patterns between wild-type and qseC mutant strains under various signaling conditions

    • Identify the complete set of genes under QseC regulatory control

    • Map temporal dynamics of transcriptional responses to QseC activation

  • Phosphoproteomics:

    • Identify proteins phosphorylated in response to QseC activation

    • Map the complete phosphotransfer cascade initiated by QseC

    • Quantify phosphorylation kinetics under different signaling conditions

  • Network Modeling:

    • Develop computational models of QseC signaling networks

    • Implement differential equation-based models to capture signaling dynamics

    • Use machine learning approaches to identify non-obvious network connections

  • Multi-omics Integration:

    • Integrate transcriptomic, proteomic, and metabolomic data for comprehensive system understanding

    • Identify emergent properties not obvious from single-omics approaches

  • In silico Prediction Validation:

    • Use model predictions to design targeted validation experiments

    • Iteratively refine models based on experimental results

These systems-level approaches can reveal emergent properties of QseC signaling networks not apparent from reductionist studies alone, particularly regarding interkingdom signaling dynamics and network robustness features.

What approaches can resolve contradictory findings in QseC research literature?

When faced with contradictory findings in the QseC literature, researchers should implement a structured resolution framework:

  • Meta-analysis Approach:

    • Systematically compare methodologies across contradictory studies

    • Identify potential sources of variation (e.g., strain differences, experimental conditions)

    • Quantitatively assess the strength of evidence for competing interpretations

  • Replication Studies:

    • Conduct direct replications of contradictory studies using identical methods

    • Implement conceptual replications using alternative methods to test robustness

    • Use collaboration networks to perform multi-lab validation studies

  • Boundary Condition Mapping:

    • Systematically vary experimental conditions to determine when each contradictory finding holds true

    • Identify context-dependent behavior that might explain apparent contradictions

  • Theoretical Reconciliation:

    • Develop theoretical frameworks that can accommodate seemingly contradictory findings

    • Test predictions from unified theories with new experiments

  • Researcher Expectation Control:

    • Implement blinded analysis protocols to minimize confirmation bias

    • Have researchers with different theoretical positions analyze the same datasets

As noted in studies of scientific cognition, embracing contradictions often leads to deeper theoretical understanding and novel insights . Contradictory findings about QseC may reflect context-dependent behavior rather than experimental error.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.