Recombinant Escherichia coli Anti-sigma-E factor RseA (rseA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your required tag type for preferential development.
Synonyms
rseA; mclA; yfiJ; b2572; JW2556; Anti-sigma-E factor RseA; Regulator of SigE; Sigma-E anti-sigma factor RseA; Sigma-E factor negative regulatory protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
rseA
Target Protein Sequence
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ
Uniprot No.

Target Background

Function
Recombinant *Escherichia coli* Anti-sigma-E factor RseA (rseA) is an anti-sigma factor for the extracytoplasmic function (ECF) sigma factor σE (RpoE). ECF sigma factors are maintained in an inactive state by anti-sigma factors until released through regulated intramembrane proteolysis (RIP). RIP is initiated by an extracytoplasmic signal, triggering a proteolytic cascade that transmits information and elicits cellular responses. This involves periplasmic cleavage (site-1 protease, S1P, DegS), followed by intramembrane cleavage (site-2 protease, S2P, RseP), and finally cytoplasmic degradation of the anti-sigma factor, liberating σE. RseA overexpression inhibits σE activity, leading to cell lysis during stationary phase and temperature sensitivity above 37°C.
Gene References Into Functions
  1. RseB binds to RseA, inhibiting its sequential cleavage and acting as a negative modulator of this response. PMID: 20512978
  2. While DegS cleavage of RseA is typically activated by porin C-termini binding to DegS's PDZ domain, RseB inhibition is independent of this activation mechanism. PMID: 17360428
  3. Two RseA molecules bind to the grooves of dimeric RseB via conserved residues. PMID: 17496148
Database Links
Protein Families
RseA family
Subcellular Location
Cell inner membrane; Single-pass type II membrane protein. Note=Following cleavage by DegS the large fragment of the protein is still in the inner membrane and retains its anti-sigma-E activity.

Q&A

What is the biological function of RseA in E. coli?

RseA is an inner membrane protein that functions as a specific anti-sigma factor for sigma(E) in Escherichia coli. It acts as the central regulatory molecule in the extracytoplasmic stress response signal transduction cascade. Under normal conditions, RseA binds to and sequesters sigma(E), preventing it from associating with RNA polymerase core enzyme and thereby inhibiting sigma(E)-dependent transcription. The activity of sigma(E) is primarily determined by the ratio of RseA to sigma(E) in the cell. When extracytoplasmic stress occurs, leading to the accumulation of misfolded or unfolded proteins, RseA is rapidly degraded, which allows the release of sigma(E) to initiate the stress response by activating relevant genes .

This regulatory mechanism ensures that the extracytoplasmic stress response is tightly controlled and only activated when necessary, preventing unnecessary energy expenditure while maintaining cellular homeostasis.

How does the structure of RseA relate to its function as an anti-sigma factor?

RseA is a transmembrane protein with distinct domains that span the inner membrane of E. coli. The cytoplasmic domain of RseA is responsible for binding to sigma(E), while its periplasmic domain serves as a sensor for extracytoplasmic stress signals. Crystal structure studies at 2 Å resolution have revealed that the cytoplasmic domain of RseA functions through steric occlusion, physically blocking the two primary binding determinants on sigma(E) that would otherwise interact with the core RNA polymerase .

Despite the sequence variability observed among anti-sigma factors, the structural mechanism is remarkably conserved. RseA binds to sigma(E) in a manner that prevents the sigma factor from interacting with RNA polymerase, effectively inhibiting transcription initiation. This structural arrangement ensures specific recognition between RseA and sigma(E), distinguishing it from other sigma factors in the cell, and provides a physical basis for the rapid response to stress conditions when RseA is degraded .

How is RseA regulated during extracytoplasmic stress?

During extracytoplasmic stress, RseA undergoes a regulated degradation process that involves multiple proteases. The initial step is carried out by the inner membrane serine protease DegS, which is activated upon sensing misfolded outer membrane proteins in the periplasm. DegS cleaves the periplasmic domain of RseA, initiating its degradation . This primary cleavage is followed by additional proteolytic events involving other proteases.

The coordinated proteolytic cascade ensures a rapid and specific response to extracytoplasmic stress. The degradation of RseA increases the pool of free sigma(E), which can then associate with RNA polymerase core enzyme to initiate transcription of genes necessary for the stress response. This regulatory mechanism allows E. coli to promptly adapt to changing environmental conditions that may compromise the integrity of its cell envelope .

What are the optimal conditions for recombinant expression of RseA in E. coli?

Recombinant expression of RseA presents challenges due to its membrane-associated nature. Based on systematic reviews of similar difficult-to-express proteins, the following conditions have proven effective for RseA expression:

ParameterRecommended ConditionRationale
Expression strainBL21(DE3) pLysS or C41(DE3)Reduced basal expression and better tolerance for membrane proteins
Growth temperature18-25°CSlower expression reduces inclusion body formation
Induction0.1-0.5 mM IPTGLower concentrations favor soluble protein production
Growth media2xYT or TB with 0.5-1% glucoseEnhanced nutrient availability reduces stress
Induction OD₆₀₀0.6-0.8Mid-log phase optimizes protein expression balance
Post-induction time16-20 hoursExtended time at lower temperature improves folding
Additives1% glycerol, 4 mM MgSO₄Stabilizes membrane proteins and improves folding

When expressing the cytoplasmic domain alone (for structural studies), inclusion of solubility tags such as MBP or SUMO can significantly enhance soluble yield. For full-length RseA, the use of specialized membrane protein expression systems with controlled expression rates is recommended to prevent overwhelming the membrane insertion machinery .

What purification strategy yields the highest purity and activity of recombinant RseA?

A multi-step purification approach is necessary to obtain highly pure and active recombinant RseA:

  • For full-length membrane-bound RseA:

    • Membrane fraction isolation using differential centrifugation

    • Solubilization with mild detergents (0.5-1% DDM or LMNG)

    • Immobilized metal affinity chromatography (IMAC) with His-tagged protein

    • Size exclusion chromatography in detergent-containing buffer

    • Optional ion exchange chromatography for higher purity

  • For the cytoplasmic domain of RseA:

    • Affinity chromatography using an appropriate tag system

    • Tag cleavage with specific protease (TEV or PreScission)

    • Reverse IMAC to remove the tag and uncleaved protein

    • Size exclusion chromatography for final polishing

The activity of purified RseA should be assessed through sigma(E) binding assays, which can be performed using surface plasmon resonance or fluorescence anisotropy. Proper folding can be verified by circular dichroism spectroscopy. The purification buffers should contain stabilizing agents such as glycerol (10%) and reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation of cysteine residues .

How can inclusion body formation be prevented when expressing recombinant RseA?

Inclusion body formation is a common challenge when expressing membrane proteins like RseA. Several strategies can be employed to enhance soluble expression:

  • Co-expression with chaperones: Co-express RseA with molecular chaperones such as GroEL/GroES, DnaK/DnaJ/GrpE, or trigger factor to assist proper folding.

  • Fusion partners: Utilize solubility-enhancing fusion partners such as MBP, SUMO, Trx, or GST at the N-terminus of RseA or its domains.

  • Expression tuning: Reduce expression rate by using weaker promoters, lower inducer concentrations, or auto-induction media.

  • Host strain engineering: Utilize E. coli strains specifically developed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3).

  • Media supplementation: Add osmolytes (sorbitol, betaine), specific metal ions, or mild detergents to the growth media to promote proper folding.

A systematic approach is recommended, testing different combinations of these strategies in small-scale expression trials before scaling up. Modern omics-based analysis can also help identify specific bottlenecks in expression and folding pathways that can be addressed through targeted interventions .

What methods are most effective for studying RseA-sigma(E) interaction dynamics?

Several complementary techniques can be employed to study the interaction dynamics between RseA and sigma(E):

  • Surface Plasmon Resonance (SPR): SPR provides real-time binding kinetics and affinity measurements. By immobilizing either RseA or sigma(E) on a sensor chip, the association and dissociation rates can be measured precisely. This approach has been successfully used with other anti-sigma factors like Rsd and AsiA to determine their binding affinities to sigma factors .

  • Fluorescence Techniques:

    • Fluorescence Resonance Energy Transfer (FRET) with labeled RseA and sigma(E)

    • Fluorescence anisotropy to measure binding in solution

    • Single-molecule FRET to observe conformational changes upon binding

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify specific regions involved in the interaction and detect conformational changes upon binding.

  • Cross-linking coupled with Mass Spectrometry: Chemical cross-linking followed by mass spectrometric analysis can identify specific residues involved in the interaction interface, similar to approaches used with Rsd .

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of binding including enthalpy, entropy, and stoichiometry.

For studying the dynamics of RseA degradation during stress response, pulse-chase experiments combined with immunoprecipitation can track the half-life of RseA under various conditions. Time-resolved structural techniques such as time-resolved X-ray crystallography or cryo-EM can capture intermediates in the interaction process.

How can site-directed mutagenesis be applied to investigate critical residues in RseA function?

Site-directed mutagenesis is a powerful approach to investigate structure-function relationships in RseA. Based on the crystal structure of the sigma(E)-RseA complex, specific residues can be targeted to elucidate their roles in binding and regulation:

  • Strategic planning of mutations:

    • Interface residues identified from the crystal structure

    • Conserved residues across RseA homologs

    • Residues at the DegS cleavage site

    • Transmembrane anchor residues

  • Types of mutations to consider:

    • Alanine scanning to identify essential residues

    • Conservative substitutions to test specific chemical properties

    • Charge reversal mutations to disrupt electrostatic interactions

    • Cysteine mutations for cross-linking studies

  • Functional assays for mutant analysis:

    • In vitro binding assays with purified components

    • In vivo reporter systems using sigma(E)-dependent promoters

    • Stability assays to assess resistance to DegS-mediated degradation

    • Structural analysis of mutant complexes

  • Comprehensive mutation matrix:

Region of RseAMutation StrategyExpected EffectAssay Method
Sigma(E) binding interfaceAlanine substitutionsReduced binding affinitySPR, ITC, Pull-down
DegS cleavage siteConservative substitutionsAltered degradation kineticsPulse-chase, Western blot
Transmembrane domainHydrophobicity alterationsChanged membrane localizationFractionation, Microscopy
Periplasmic domainDeletion mappingIdentified stress sensing regionsStress response assays

When interpreting mutagenesis results, it's important to distinguish between effects on protein stability versus specific functional defects. Combining mutagenesis with structural studies provides the most comprehensive understanding of structure-function relationships in RseA.

What are the most effective in vivo assays for studying RseA function in the context of the E. coli stress response?

Several sophisticated in vivo assays can be employed to study RseA function in physiological contexts:

  • Reporter gene systems:

    • Transcriptional fusions of sigma(E)-dependent promoters to reporter genes (lacZ, gfp, luciferase)

    • Dual-reporter systems to normalize for cell number and metabolic state

    • Time-lapse microscopy with fluorescent reporters to track single-cell dynamics

  • Genetic approach techniques:

    • Precise chromosomal modifications using CRISPR-Cas9 or recombineering

    • Regulated expression systems (tetracycline-inducible, arabinose-inducible)

    • Depletion strains for essential components using degron tags

  • Physiological stress induction methods:

    • Heat shock (42°C) to induce protein misfolding

    • Ethanol treatment (3-5%) to disrupt membrane integrity

    • Overexpression of outer membrane proteins to saturate assembly pathways

    • Chemical inducers (e.g., 2% SDS, EDTA) to compromise membrane integrity

  • Advanced analytical techniques:

    • ChIP-seq to identify sigma(E) binding sites genome-wide

    • RNA-seq to profile the complete sigma(E) regulon

    • Ribosome profiling to assess translational responses

    • Quantitative proteomics to measure protein level changes

A particularly powerful approach combines controlled expression of RseA variants with global transcriptomic or proteomic profiling to identify genes differentially regulated under specific conditions. This can reveal unexpected regulatory connections within the stress response network .

How does the mechanism of RseA action compare with other E. coli anti-sigma factors like Rsd?

RseA and Rsd represent different classes of anti-sigma factors in E. coli, with distinct mechanisms of action and regulatory contexts:

FeatureRseA (Anti-sigma-E)Rsd (Anti-sigma-70)
Target sigma factorSigma(E) (stress response)Sigma(70) (housekeeping)
Cellular locationInner membrane proteinCytoplasmic protein
Expression timingConstitutiveStationary phase-induced
Structural mechanismSteric occlusion of core RNAP binding determinantsInteraction with region 4 of sigma(70) and other regions
SpecificityHighly specific for sigma(E)Interacts with sigma(70) but also sigma(38)
Regulatory roleControls envelope stress responseModulates sigma factor competition during stationary phase
Release mechanismRegulated proteolysis by DegSUnknown, possibly competitive binding

While RseA functions by sterically blocking sigma(E) from binding to RNA polymerase core enzyme , Rsd has been shown to interact not only with sigma(70) but also with the core enzyme of RNA polymerase and can form dimers in solution . Interestingly, Rsd also interacts with sigma(38) (the stationary phase sigma factor), although competitive in vitro transcription experiments show selective inhibition of sigma(70)-dependent transcription .

Unlike the T4 phage anti-sigma factor AsiA, which can form a stable ternary complex with RNA polymerase, neither RseA nor Rsd appear to function this way. This suggests that different anti-sigma factors have evolved distinct mechanisms to regulate transcription initiation, reflecting their specific physiological roles in bacterial adaptation to environmental changes .

What insights from other anti-sigma factor systems can be applied to RseA research?

Research on diverse anti-sigma factor systems has revealed principles and approaches that can be productively applied to RseA studies:

  • Structural insights: The crystal structure of the sigma(E)-RseA complex shows that despite sequence divergence, the structural mechanism of inhibition shares commonalities with other anti-sigma factors. The comparison with AsiA-sigma(70) and Rsd-sigma(70) interactions can inform the design of experiments to probe specific aspects of binding specificity and affinity .

  • Regulatory network analysis: Studies on Rsd expression regulation revealed complex control by nucleoid-associated proteins (H-NS, FIS, StpA, LRP), the stationary phase sigma factor RpoS, and the transcription factor DksA . Similar multilayered regulation may exist for RseA, suggesting that comprehensive promoter analysis and transcription factor binding studies should be conducted.

  • Methylation-dependent regulation: The finding that dam-dependent methylation of GATC sites is important for efficient rsd transcription raises the possibility that epigenetic mechanisms may also influence RseA expression or function, an area that remains largely unexplored.

  • In vitro competition assays: The methodology developed for studying Rsd's differential effects on sigma(70) and sigma(38) using competitive in vitro transcription could be adapted to investigate whether RseA might have secondary targets beyond sigma(E), or to explore how the system responds to varying ratios of components.

  • Post-translational modifications: Research on other anti-sigma factors has revealed roles for phosphorylation, proteolytic processing, and redox-sensing in regulating activity. Similar modifications might fine-tune RseA function beyond the established proteolytic regulation.

By integrating these insights from parallel systems, researchers can develop more nuanced models of RseA function and regulation in the context of bacterial stress responses.

How can expression yield and solubility of recombinant RseA be optimized?

Optimizing expression and solubility of recombinant RseA requires a systematic approach addressing multiple factors:

  • Vector design optimization:

    • Codon optimization for E. coli expression

    • Signal sequence modifications for membrane targeting

    • Fusion with solubility tags (MBP, SUMO, Trx)

    • Inclusion of appropriate protease cleavage sites

    • Use of low-copy number vectors to prevent overexpression toxicity

  • Expression strain selection:

    • BL21(DE3) derivatives optimized for membrane proteins

    • C41(DE3) and C43(DE3) for toxic proteins

    • Rosetta strains for rare codon usage

    • SHuffle strains for disulfide bond formation

  • Culture condition optimization matrix:

ParameterVariables to TestMonitoring Method
Temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blot
Media compositionLB, TB, 2xYT, M9, auto-inductionCell density, protein yield
Inducer concentration0.01-1.0 mM IPTG rangeExpression level, solubility
AdditivesGlycerol, sucrose, betaine, ethanol, saltSoluble fraction analysis
Induction timeOD₆₀₀ 0.4-1.0Growth curve correlation
Harvest time3h, 6h, overnightTime-course analysis
  • Solubilization strategies for membrane-bound RseA:

    • Screen multiple detergents (DDM, LMNG, LDAO, OG)

    • Test detergent concentration ranges

    • Evaluate detergent-to-protein ratios

    • Consider bicelles or nanodiscs for structural studies

  • Stabilization approaches:

    • Addition of specific ligands or binding partners

    • Inclusion of glycerol or specific ions

    • Optimization of pH and ionic strength

    • Use of protease inhibitors to prevent degradation

Systematic testing using small-scale expression trials followed by solubility analysis can identify optimal conditions before scaling up. Modern high-throughput approaches using parallel expression systems can accelerate this optimization process .

What are the common pitfalls in RseA functional assays and how can they be addressed?

Several common challenges arise in RseA functional studies, each requiring specific troubleshooting approaches:

  • Protein instability issues:

    • Problem: Rapid degradation of RseA during purification or assays

    • Solution: Include protease inhibitors, reduce temperature, minimize handling time, consider stabilizing mutations or fusion partners

  • Non-specific binding in pull-down assays:

    • Problem: High background or false positives in interaction studies

    • Solution: Optimize salt concentration and detergent levels, use more stringent washing, include competing proteins, validate with alternative binding assays

  • Inconsistent activity measurements:

    • Problem: Variable results in sigma(E) binding or inhibition assays

    • Solution: Standardize protein preparations, ensure consistent buffer conditions, include internal controls, develop quantitative readouts

  • Artificial activation during membrane extraction:

    • Problem: Unintended proteolytic activation during sample preparation

    • Solution: Work at low temperature, use protease inhibitors, develop gentler extraction protocols, validate native state with antibodies against different epitopes

  • Confounding factors in in vivo assays:

    • Problem: Indirect effects masking direct RseA function

    • Solution: Include appropriate controls, use multiple reporter systems, validate with in vitro reconstituted systems, perform complementation tests

  • Troubleshooting table for common assay issues:

Assay TypeCommon IssueDiagnostic ApproachSolution Strategy
In vitro bindingPoor reproducibilityAnalyze protein quality by SECStandardize preparation protocols
Reporter geneHigh backgroundTest in sigma(E) deletion strainOptimize promoter-reporter constructs
Protein-protein interactionFalse negativesTest positive controlsModify buffer conditions, tags, or detection method
Degradation kineticsSpontaneous degradationTime-zero controlsAdd stabilizing agents, optimize buffer
Stress responsePleiotropic effectsGene expression profilingUse more specific stress inducers

Maintaining detailed records of experimental conditions and systematically testing variables can help identify and eliminate sources of variability in RseA functional assays.

How can researchers address contradictory findings in RseA literature?

Scientific literature sometimes contains apparently contradictory findings about RseA function or regulation. A structured approach to resolving such discrepancies includes:

Contradictory FindingPossible ExplanationResolution Approach
Different binding affinitiesBuffer conditions, tags, or protein qualityDirect comparison under identical conditions
Varied stress response phenotypesStrain background differencesIsogenic strain construction and testing
Conflicting interaction partnersDetection sensitivity, non-specific bindingValidation with multiple interaction methods
Disagreement on regulatory mechanismsOverlooked post-translational modificationsComprehensive mass spectrometry analysis
Different subcellular localizationSample preparation artifactsLive cell imaging with minimal perturbation

Collaborative research initiatives that bring together labs with different expertise can be particularly effective in resolving contradictory findings by applying diverse approaches to address the same scientific question.

What are the emerging techniques that could advance RseA research?

Several cutting-edge technologies are poised to transform our understanding of RseA function and regulation:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structures of the complete RseA-sigma(E) complex in different states

    • Visualization of the membrane-embedded portions of RseA

    • Structural determination of larger assemblies including the RNA polymerase holoenzyme

  • Single-molecule techniques:

    • Single-molecule FRET to observe dynamic conformational changes

    • Optical tweezers to measure binding and unbinding forces

    • Super-resolution microscopy to track RseA localization and dynamics in living cells

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing for precise manipulation of RseA and interacting partners

    • CRISPRi for conditional repression to study essentiality

    • Base editing for introducing specific point mutations without selection markers

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to map the full impact of RseA regulation

    • Network analysis to identify new regulatory connections

    • Mathematical modeling of the complete envelope stress response

  • Microfluidics and high-throughput screening:

    • Single-cell analysis of stress response heterogeneity

    • Droplet-based assays for protein-protein interactions

    • Massively parallel functional variant analysis using deep mutational scanning

These emerging technologies will enable researchers to address long-standing questions about RseA with unprecedented precision and to explore new aspects of its function that have been technically challenging to investigate using conventional approaches.

What are the unexplored aspects of RseA function that warrant investigation?

Despite significant progress in understanding RseA, several important aspects remain incompletely explored:

  • Temporal dynamics of RseA degradation:

    • Real-time monitoring of RseA proteolysis during stress response

    • Identification of rate-limiting steps in the degradation cascade

    • Potential feedback mechanisms regulating degradation kinetics

  • Post-translational modifications beyond proteolysis:

    • Phosphorylation, acetylation, or other modifications affecting function

    • Changes in modification states during different growth phases

    • Enzymatic regulators of these modifications

  • Membrane microdomain localization:

    • Potential clustering of RseA in specific membrane regions

    • Co-localization with other envelope stress sensing systems

    • Lipid interactions that might modulate activity

  • Evolution and adaptation of the RseA-sigma(E) system:

    • Comparative analysis across bacterial species

    • Identification of variable regions that may confer species-specific functions

    • Evolutionary constraints on the anti-sigma factor mechanism

  • Integration with other stress response pathways:

    • Cross-talk with other envelope stress response systems

    • Connection to central metabolic regulation

    • Role in biofilm formation and antibiotic resistance

  • Exploration of potential additional functions:

    • Possible moonlighting roles beyond sigma(E) regulation

    • Interactions with other cellular components

    • Functions of degradation products

These unexplored areas represent promising avenues for future research that could significantly expand our understanding of bacterial stress response regulation and potentially reveal new targets for antimicrobial development.

How might RseA research contribute to broader understanding of bacterial stress responses and potential antimicrobial targets?

Research on RseA has implications that extend well beyond its specific molecular function, potentially informing several critical areas:

  • Fundamental principles of signal transduction:

    • The RseA-sigma(E) system represents a paradigm for transmembrane signal transduction that may reveal generalizable principles applicable to other signaling systems

    • Understanding how protein degradation can serve as a precise regulatory mechanism

    • Insights into how bacteria integrate multiple stress signals through coordinated proteolysis

  • Bacterial adaptation mechanisms:

    • RseA regulation illuminates how bacteria maintain envelope integrity under stress

    • Understanding of the balance between housekeeping and stress-response gene expression

    • Mechanisms of rapid reprogramming of transcription in response to environmental changes

  • Evolution of regulatory networks:

    • Comparison of RseA with other anti-sigma factors reveals evolutionary solutions to similar regulatory challenges

    • Insights into the co-evolution of interacting protein pairs

    • Understanding of how complex regulatory networks arise and diversify

  • Novel antimicrobial strategies:

    • Targeting the RseA-sigma(E) interaction could prevent bacterial adaptation to host defenses

    • Disrupting stress responses could potentiate existing antibiotics

    • The potential development of anti-virulence strategies that don't drive resistance

  • Implications for synthetic biology:

    • Engineering stress response circuits for biotechnological applications

    • Development of biosensors based on the RseA-sigma(E) system

    • Creation of bacterial strains with enhanced stress tolerance for industrial processes

By elucidating the molecular mechanisms and regulatory networks controlling RseA function, researchers can gain insights that transcend this specific system and contribute to our broader understanding of bacterial physiology, evolution, and potential vulnerabilities that could be exploited for therapeutic purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.