Recombinant Escherichia coli Sigma-E factor regulatory protein RseC (rseC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rseC; b2570; JW2554; Protein RseC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
rseC
Target Protein Sequence
MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLV PGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDVAALCGAILGGIGGFLI ARGYSRKFAARAEWQPIILSVALPPGLVRFETSSEDASQ
Uniprot No.

Target Background

Function
RseC may play a role in reducing the SoxR iron-sulfur cluster and may function in conjunction with the RsxABCDGE complex.
Database Links
Protein Families
RseC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of RseC protein in E. coli?

RseC is a membrane protein with a distinctive topology consisting of two transmembrane helices. Both the N-terminal and C-terminal domains are positioned in the cytoplasm, as confirmed through bacterial two-hybrid analysis and computational predictions using TMHMM and AlphaFold. The first transmembrane helix spans amino acids 72-99, while the second spans positions 104-129. This topology has been experimentally verified using translational fusion of reporter enzymes (β-galactosidase and alkaline phosphatase) at specific positions .

Methodological approach for topology determination:

  • Generate translational fusions with reporter enzymes (LacZ and PhoA) at different positions

  • Measure enzyme activities to determine cellular localization

  • Compare experimental data with computational predictions

  • Use bacterial two-hybrid system to confirm domain interactions

What cysteine motifs are present in RseC and what is their significance?

RseC contains a characteristic four-cysteine motif (CX5CX2CX5C) in its N-terminal domain, with the latter three cysteines (at positions 26, 29, and 35) being highly conserved across bacterial species. The first cysteine at position 20 shows less conservation and is not essential for RseC function in the SoxR reducer complex. These conserved cysteines can form an oxygen-sensitive Fe-S cluster, which appears to be critical for RseC functionality .

Conservation pattern across bacterial species:

SpeciesCys20Cys26Cys29Cys35
E. coliYesYesYesYes
Y. pestisYesYesYesYes
V. choleraeYesYesYesYes
P. aeruginosaNoYesYesYes
B. fragilisNoYesYesYes

How is the rseC gene organized in the E. coli genome?

The rseC gene is encoded within the rpoE-rseABC operon in E. coli. It is positioned downstream of the alternative sigma factor σE (encoded by rpoE) and the regulatory genes rseA and rseB. This operon organization is significant because it physically and functionally links RseC to the extracytoplasmic stress response regulated by σE. This genomic arrangement facilitates co-expression of these functionally related proteins, ensuring their coordinated production in response to cellular stresses .

What are the recommended methods for overexpressing and purifying recombinant RseC?

Recombinant RseC overexpression presents specific challenges due to its membrane-associated nature and the oxygen-sensitive Fe-S cluster in its N-terminal domain. For successful expression and purification:

  • Expression systems:

    • Use pET3a or pET15b vectors for controlled expression

    • Transform into E. coli expression strains (BL21 or derivatives)

    • Consider low-temperature induction (16-20°C) to improve protein folding

  • Domain-specific considerations:

    • N-terminal domain alone (up to 70 amino acids) tends to form inclusion bodies

    • Full-length protein is required for complete functionality

    • Expression under microaerobic conditions may improve Fe-S cluster stability

  • Purification strategy:

    • Use detergent solubilization for membrane extraction (e.g., n-dodecyl-β-D-maltoside)

    • Consider affinity tags (His-tag) for purification

    • Perform purification steps under reducing conditions to preserve cysteine integrity

    • Include protease inhibitors to prevent degradation

What experimental approaches can be used to study the Fe-S cluster formation in RseC?

The oxygen-sensitive Fe-S cluster in RseC's N-terminal domain requires specialized techniques for characterization:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to detect characteristic absorption patterns of Fe-S clusters

    • Electron paramagnetic resonance (EPR) spectroscopy for Fe-S cluster state determination

    • Mössbauer spectroscopy to characterize iron oxidation states

  • Reconstitution experiments:

    • In vitro Fe-S cluster reconstitution under anaerobic conditions

    • Use of iron sources (ferrous ammonium sulfate) and sulfide donors (sodium sulfide)

    • Monitoring cluster assembly with UV-visible spectroscopy

  • Mutagenesis approaches:

    • Site-directed mutagenesis of conserved cysteines (C26, C29, C35)

    • Assessment of mutant proteins for cluster formation and function

    • Use QuikChange Site-Directed Mutagenesis Kit for precise alterations

How does RseC contribute to the SoxR reducing system in E. coli?

RseC functions as a component of the SoxR reducing system, which maintains SoxR in its reduced (inactive) state under normal conditions. The mechanism involves:

  • RseC interacts with proteins encoded by the rsxABCDGE operon and ApbE to form the SoxR reducer complex.

  • The conserved cysteine motif in RseC's N-terminal domain appears to participate in electron transfer, potentially through its Fe-S cluster.

  • This reducing system prevents inappropriate activation of the SoxRS regulon, which controls genes involved in oxidative stress response and antibiotic resistance.

  • When RseC is absent, cells may show increased sensitivity to redox-cycling compounds due to altered regulation of the SoxR transcription factor .

Experimental evidence for RseC's role in SoxR reduction:

  • Complementation studies with full-length vs. truncated RseC

  • Differential sensitivity of rseC mutants to oxidative stressors

  • Protein interaction studies with other components of the SoxR reducer complex

What is the relationship between RseC and the σE-mediated stress response?

While RseC is encoded in the same operon as the σE regulatory proteins RseA and RseB, its role in σE regulation appears to be distinct:

  • Unlike RseA (an anti-sigma factor) and RseB (a negative regulator), deletion of rseC has no significant effect on σE activity under steady-state conditions.

  • RseC may be involved in alternative regulatory pathways that influence cellular responses to extracytoplasmic stress.

  • The σE-mediated stress response is activated by the accumulation of misfolded outer membrane proteins in the periplasm, leading to increased production of stress-response proteins like DegP.

  • RseC may serve as a link between different stress response systems, potentially connecting membrane integrity monitoring with oxidative stress responses .

Does RseC have functions independent of the SoxR and σE systems?

Evidence suggests RseC has additional roles beyond its involvement in the SoxR reducer complex:

  • The rseC mutant exhibits differential sensitivity to hydrogen peroxide in both exponential and stationary growth phases, independent of the SoxR regulon.

  • RseC is present in anaerobic bacteria that lack SoxR, suggesting evolutionarily conserved alternative functions.

  • In some bacteria like Clostridium ljungdahlii, RseC homologs participate in transcriptional regulation of the rnf operon.

  • The relationship between RseC and membrane function suggests potential roles in maintaining membrane integrity or monitoring transmembrane electron transport systems.

Researchers investigating these independent functions should consider comparative genomic approaches and phenotypic characterization across different stress conditions to elucidate these alternative roles .

What experimental designs are most appropriate for studying RseC function in vivo?

For rigorous in vivo investigation of RseC function, consider these experimental design approaches:

  • Genetic complementation studies:

    • Generate clean deletions of rseC using lambda Red recombineering

    • Complement with wild-type and mutant variants (especially cysteine mutants)

    • Test under various stress conditions (oxidative, membrane, stationary phase)

  • Reporter systems for functional assessment:

    • Transcriptional fusions to monitor SoxS-dependent gene expression

    • Protein stability assays to measure SoxR redox state

    • Membrane integrity reporters to assess potential roles in membrane function

  • Time-resolved experimental approaches:

    • Interrupted time series designs to capture dynamic responses

    • Pre-post designs with non-equivalent control groups

    • Stepped wedge designs for sequential introduction of genetic modifications

  • Physiological characterization:

    • Measure intracellular NADPH and iron levels in wild-type vs. rseC mutants

    • Assess sensitivity to various oxidative stressors (H2O2, redox-cycling agents)

    • Evaluate growth and survival under different physiological conditions

How can researchers address the challenges of studying oxygen-sensitive Fe-S clusters in RseC?

The oxygen-sensitive nature of RseC's Fe-S cluster presents significant experimental challenges. Consider these methodological approaches:

  • Anaerobic techniques:

    • Use anaerobic chambers or glove boxes for protein handling

    • Employ oxygen-scavenging systems in buffers

    • Prepare samples under nitrogen or argon atmosphere

  • Spectroscopic approaches for intact cells:

    • Whole-cell EPR spectroscopy to observe Fe-S clusters in vivo

    • Rapid freezing techniques to capture native states

    • Comparative analysis between aerobic and anaerobic conditions

  • Structural stabilization strategies:

    • Express full-length RseC rather than isolated domains

    • Include the C-terminal domain, which appears to stabilize the N-terminal region

    • Use protein engineering approaches to improve stability while maintaining function

  • Alternative detection methods:

    • Thiol-labeling techniques to monitor cysteine accessibility

    • Fe55 or S35 incorporation assays to track cluster assembly

    • Cross-linking studies to capture transient interactions

What methodological approaches can distinguish between SoxR-dependent and SoxR-independent functions of RseC?

Differentiating between SoxR-dependent and SoxR-independent functions of RseC requires sophisticated experimental design:

  • Genetic dissection approach:

    • Create double mutants (ΔrseC ΔsoxR) to eliminate confounding SoxR effects

    • Use SoxR constitutively active mutants with and without RseC

    • Generate targeted mutations in RseC that specifically disrupt SoxR interaction

  • Transcriptomic analysis:

    • Compare RNA-seq profiles of ΔrseC, ΔsoxR, and double mutants

    • Identify RseC-dependent genes not affected by SoxR status

    • Perform differential expression analysis under various stress conditions

  • Biochemical interaction studies:

    • Use pull-down assays to identify RseC interaction partners beyond SoxR system

    • Perform bacterial two-hybrid screening to find novel interactors

    • Use cross-linking mass spectrometry to map protein interaction networks

  • Physiological characterization under controlled conditions:

    • Compare phenotypes in the presence of specific stressors (H2O2, membrane stress)

    • Measure intracellular parameters (iron levels, NADPH, membrane potential)

    • Assess growth and survival in defined media with varying stress conditions

How conserved is RseC across bacterial species and what does this suggest about its function?

RseC shows interesting patterns of conservation that provide insights into its function:

  • The three-cysteine motif (CX2CX5C) in the N-terminal domain is highly conserved in RseC homologs across diverse bacterial species, suggesting functional importance.

  • RseC is absent in actinomycetes that possess SoxR but is present in anaerobic bacteria lacking SoxR, indicating that its function as a SoxR reducer is not universally conserved.

  • In some bacteria, such as Vibrio cholerae and Acetobacterium woodii, the Rnf complex (related to the SoxR reducing system) can be assembled without RseC.

  • The RseC homolog in Rhodospirillum capsulatus (RnfF) contains additional cysteine motifs not present in E. coli RseC, suggesting functional specialization.

Evolutionary implications:

  • The variable conservation pattern suggests multiple functional roles for RseC

  • The consistent linkage with membrane function across species indicates core functionality

  • The presence in diverse bacterial phyla suggests ancient evolutionary origins for this protein family

How does RseC differ from its homologs in other bacterial species?

RseC exhibits notable differences from its homologs in other bacterial species:

Structural variations:

SpeciesProtein NameTM HelicesCysteine MotifsGenomic Context
E. coliRseC2CX5CX2CX5CrpoE-rseABC operon
R. capsulatusRnfF2CX2CX5C, CX3CXCX2Crnf operon
P. aeruginosaMucC2-X-CX2CX5CalgU-mucABCD operon
C. ljungdahliiRseC-like2CX2CX5CInvolved in rnf regulation

Functional differences:

  • R. capsulatus RnfF has additional cysteine motifs and is directly involved in electron transport

  • P. aeruginosa MucC is part of the alginate production regulatory system

  • Some homologs are associated with specific electron transport functions rather than stress responses

  • The genomic context varies significantly, affecting co-expression patterns

What quantitative approaches can be used to measure RseC-dependent resistance to oxidative stress?

To quantitatively assess RseC's contribution to oxidative stress resistance:

  • Growth inhibition assays:

    • Measure growth curves in the presence of increasing concentrations of oxidative stressors

    • Calculate IC50 values for various oxidants in wild-type vs. rseC mutant strains

    • Perform time-kill assays to assess survival kinetics under stress

  • Intracellular ROS measurement:

    • Use fluorescent probes (H2DCFDA, DHE) to quantify specific reactive oxygen species

    • Employ flow cytometry for single-cell analysis of ROS levels

    • Measure oxidative damage to cellular components (lipid peroxidation, protein carbonylation)

  • Enzyme activity assays:

    • Measure activities of antioxidant enzymes (catalase, superoxide dismutase)

    • Assess NADPH oxidation rates as an indicator of reducing capacity

    • Monitor the redox state of specific cellular components

  • Statistical analysis:

    • Use appropriate statistical methods for data analysis (ANOVA, t-tests)

    • Apply mathematical modeling to describe stress response dynamics

    • Consider factorial experimental designs to assess interactions between variables

How can researchers effectively study protein-protein interactions involving RseC?

For comprehensive analysis of RseC protein interactions:

  • In vivo interaction studies:

    • Bacterial two-hybrid (BACTH) system for initial screening

    • Co-immunoprecipitation with specific antibodies or epitope tags

    • FRET/BRET approaches for monitoring interactions in live cells

  • In vitro interaction characterization:

    • Pull-down assays with purified components

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Structural approaches:

    • Cross-linking coupled with mass spectrometry to map interaction sites

    • Hydrogen-deuterium exchange mass spectrometry for interface mapping

    • Cryo-EM for larger complexes containing RseC

  • Membrane protein-specific techniques:

    • Detergent screening to maintain native interactions

    • Nanodiscs or liposome reconstitution to study membrane context effects

    • Chemical cross-linking optimized for membrane protein complexes

What are the best experimental controls when studying RseC function in relation to oxidative stress?

Proper experimental controls are crucial for reliable RseC research:

  • Genetic controls:

    • Empty vector controls for complementation studies

    • Point mutants affecting specific functions (cysteine mutations)

    • Double/triple mutants to control for genetic interactions

    • Clean genetic backgrounds without unintended mutations

  • Environmental controls:

    • Precise control of growth conditions (temperature, media, aeration)

    • Standardized protocols for stress agent preparation and application

    • Time-matched sampling for temporal comparisons

    • Controlled oxygen levels for Fe-S cluster studies

  • Technical controls:

    • Standard curves for all quantitative measurements

    • Internal controls for normalization (housekeeping genes, constitutive markers)

    • Positive and negative controls for each assay

    • Multiple technical and biological replicates

  • Statistical considerations:

    • Appropriate sample sizes based on power analysis

    • Randomization and blinding where applicable

    • Proper statistical tests with corrections for multiple comparisons

    • Transparent reporting of all experimental variables

What are common challenges in RseC purification and how can they be addressed?

Researchers working with RseC frequently encounter these challenges:

  • Protein instability issues:

    • Challenge: The N-terminal domain with its oxygen-sensitive Fe-S cluster is unstable when expressed alone

    • Solution: Express full-length protein to maintain the stabilizing effect of the C-terminal domain

    • Solution: Use anaerobic conditions during purification to preserve Fe-S cluster integrity

  • Inclusion body formation:

    • Challenge: Overexpressed RseC tends to form inclusion bodies

    • Solution: Lower expression temperature (16-20°C) and IPTG concentration

    • Solution: Use solubility-enhancing fusion tags (MBP, SUMO)

    • Solution: Optimize cell lysis conditions to improve membrane protein extraction

  • Low yield problems:

    • Challenge: Membrane proteins typically express at lower levels

    • Solution: Scale up culture volume and optimize induction conditions

    • Solution: Use specialized E. coli strains designed for membrane protein expression

    • Solution: Consider codon optimization for higher expression levels

  • Loss of function during purification:

    • Challenge: Native function depends on membrane environment and Fe-S cluster

    • Solution: Use gentle detergents for extraction (DDM, LMNG)

    • Solution: Include reducing agents throughout purification

    • Solution: Consider membrane reconstitution systems for functional studies

How can researchers address the challenge of studying RseC's dual membrane and cytoplasmic functions?

The dual localization of RseC presents methodological challenges that can be addressed through:

  • Compartment-specific functional assays:

    • Develop assays that specifically measure cytoplasmic functions (Fe-S cluster assembly, interaction with SoxR)

    • Design separate assays for membrane-associated functions (electron transport, membrane integrity)

    • Use cellular fractionation to isolate and study RseC in different compartments

  • Domain-specific analysis:

    • Create chimeric proteins with domain swaps to isolate specific functions

    • Use truncation constructs with appropriate localization signals

    • Perform site-directed mutagenesis targeting residues in different domains

  • Localization-controlled experimental designs:

    • Use inducible targeting signals to control RseC localization

    • Apply membrane-permeable and impermeable reagents to distinguish compartment-specific effects

    • Employ super-resolution microscopy to track RseC localization under different conditions

  • Integrated approaches:

    • Combine biochemical, genetic, and physiological methods

    • Use systems biology approaches to model complex interactions

    • Apply metabolic flux analysis to understand the impact on cellular metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.