Recombinant Escherichia coli Signal transduction histidine-protein kinase AtoS (atoS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atoS; b2219; JW2213; Signal transduction histidine-protein kinase AtoS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
atoS
Target Protein Sequence
MHYMKWIYPRRLRNQMILMAILMVIVPTLTIGYIVETEGRSAVLSEKEKKLSAVVNLLNQ ALGDRYDLYIDLPREERIRALNAELAPITENITHAFPGIGAGYYNKMLDAIITYAPSALY QNNVGVTIAADHPGREVMRTNTPLVYSGRQVRGDILNSMLPIERNGEILGYIWANELTED IRRQAWKMDVRIIIVLTAGLLISLLLIVLFSRRLSANIDIITDGLSTLAQNIPTRLPQLP GEMGQISQSVNNLAQALRETRTLNDLIIENAADGVIAIDRQGDVTTMNPAAEVITGYQRH ELVGQPYSMLFDNTQFYSPVLDTLEHGTEHVALEISFPGRDRTIELSVTTSRIHNTHGEM IGALVIFSDLTARKETQRRMAQAERLATLGELMAGVAHEVRNPLTAIRGYVQILRQQTSD PIHQEYLSVVLKEIDSINKVIQQLLEFSRPRHSQWQQVSLNALVEETLVLVQTAGVQARV DFISELDNELSPINADRELLKQVLLNILINAVQAISARGKIRIQTWQYSDSQQAISIEDN GCGIDLSLQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIRVASLPGYGATFTLILPI NPQGNQTV
Uniprot No.

Target Background

Function

AtoS is a member of the two-component regulatory system AtoS/AtoC. In the presence of acetoacetate, AtoS/AtoC stimulates expression of the atoDAEB operon, leading to short-chain fatty acid catabolism and activation of the poly-(R)-3-hydroxybutyrate (cPHB) biosynthetic pathway. It also induces the operon in response to spermidine. AtoS is involved in regulating motility and chemotaxis through transcriptional induction of the flagellar regulon. It is a membrane-associated kinase that phosphorylates and activates AtoC in response to environmental signals.

Gene References Into Functions
  1. AtoS, a membrane protein, autophosphorylates and subsequently transfers the phosphoryl group to AtoC. The atoS and atoC gene products form a two-component signal transduction system with unusual properties, regulating the atoDAEB operon. PMID: 16153782
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional organization of the AtoS histidine kinase in E. coli?

AtoS functions as the sensor component within the AtoS-AtoC two-component system (TCS) in E. coli. Structurally, AtoS follows the typical organization of bacterial histidine kinases, consisting of a sensor domain that detects environmental signals and a catalytic autokinase domain . The protein contains transmembrane regions and a cytoplasmic portion responsible for signal transduction. AtoS has demonstrated the ability to autophosphorylate, albeit at a relatively low rate compared to other histidine kinases . Its primary function involves detecting specific stimuli (primarily acetoacetate) and subsequently phosphorylating its cognate response regulator, AtoC/Az, which then activates transcription of target genes . The functional relationship between these domains operates through allosteric mechanisms rather than through simple linear conformational changes .

How does the AtoS-AtoC two-component system regulate metabolic pathways in E. coli?

The AtoS-AtoC two-component system plays a critical role in regulating short-chain fatty acid metabolism in E. coli. Upon activation by acetoacetate, AtoS phosphorylates AtoC, which then functions as a transcriptional activator for the atoDAEB operon . This operon encodes enzymes essential for the catabolism of short-chain fatty acids, particularly acetoacetate . Additionally, the AtoS-AtoC system has been demonstrated to enhance poly-hydroxy-butyrate (cPHB) biosynthesis in E. coli, suggesting its involvement in multiple metabolic pathways . Recent global analyses have revealed that this TCS extends its regulatory influence beyond metabolism to processes such as flagella synthesis, chemotaxis, and sodium sensitivity, indicating a broader role in bacterial physiology than previously understood .

What experimental methods are commonly used to study AtoS phosphorylation activity?

Several methodological approaches are employed to study AtoS phosphorylation activity:

  • Recombinant protein expression and purification: His-tagged fusion proteins of AtoS (particularly the cytosolic domain) can be expressed and purified for in vitro studies .

  • Autophosphorylation assays: Using purified recombinant AtoS with radioactively labeled ATP (typically [γ-32P]ATP) to detect the autophosphorylation activity through radiography or scintillation counting.

  • Trans-phosphorylation assays: Examining the ability of AtoS to transfer phosphoryl groups to AtoC, which can be monitored using purified recombinant proteins .

  • Cysteine-crosslinking assays: These can be used to probe conformational changes in the protein during signal transduction, similar to approaches used with other histidine kinases .

  • Reporter gene assays: Constructing transcriptional fusions between AtoC-regulated promoters and reporter genes (such as lacZ) to indirectly measure AtoS activity in vivo .

How does interdomain communication function in AtoS signal transduction?

The signal transduction mechanism in AtoS, like other histidine kinases, operates through complex interdomain allosteric communications rather than through a simple propagation of conformational changes . Research suggests that AtoS contains multiple domains that can adopt either kinase-promoting or kinase-inhibiting conformations, with these domains being in allosteric communication with each other . The mechanism involves a thermodynamic coupling between domains, where changes in one domain's conformational equilibrium affect the conformational states of adjacent domains .

Experimental evidence from studies on similar histidine kinases indicates that the catalytic domain intrinsically favors a constitutively "kinase-on" conformation, while intermediate domains (such as HAMP domains) may favor "kinase-off" states . When coupled together, these opposing preferences create a bistable system that can respond sensitively to environmental signals . Mutations can alter signaling by locally modulating domain intrinsic equilibrium constants and interdomain couplings, enabling fine-tuning of the response .

What is the role of AtoS in cross-regulation with other two-component systems?

Cross-regulation between AtoS-AtoC and other two-component systems, particularly EnvZ-OmpR, has been reported in E. coli . This cross-talk represents an important mechanism for integrating diverse environmental signals and coordinating appropriate cellular responses. Specifically, mutations in the EnvZ-OmpR system have been shown to affect the expression of atoC, indicating regulatory interactions between these pathways .

The molecular basis for this cross-regulation may involve:

  • Phosphorylation cross-talk, where kinases can phosphorylate non-cognate response regulators under certain conditions

  • Transcriptional regulatory interactions, where one TCS affects the expression of components of another TCS

  • Protein-protein interactions between components of different TCS pathways

Understanding these cross-regulatory mechanisms is crucial for developing a comprehensive model of bacterial signal transduction networks and their role in coordinating cellular responses to environmental changes.

How do mutations in the AtoS sensor domain affect signal transduction efficiency?

Mutations in the AtoS sensor domain can significantly alter signal transduction efficiency by modifying the protein's ability to detect environmental stimuli or by affecting the conformational changes necessary for activation. Based on studies of similar histidine kinases, conservative single-site mutations distant from the sensor or catalytic site can strongly influence ligand sensitivity as well as the magnitude and direction of the signal .

These effects can be understood through a three-domain allosteric model where mutations:

  • Alter the intrinsic equilibrium constants of individual domains (shifting the balance between "on" and "off" states)

  • Modify the coupling strength between adjacent domains

  • Change the protein's response to its natural ligand (acetoacetate)

For example, mutations that destabilize the thermodynamically preferred state of intermediate signaling domains or reduce coupling to the autokinase would allosterically increase kinase activity . Conversely, mutations that stabilize inhibitory conformations would reduce signaling efficiency.

What are the best approaches for creating recombinant AtoS constructs for in vitro studies?

Designing effective recombinant AtoS constructs requires careful consideration of domain structure and protein solubility. Based on successful approaches with similar histidine kinases, the following methodology is recommended:

  • Domain analysis: Conduct bioinformatic analysis to identify the boundaries of functional domains (sensor, HAMP, catalytic) to design appropriate constructs.

  • Expression vectors: Clone the full-length AtoS or specific domains into expression vectors with appropriate fusion tags (His-tag, MBP, GST) to facilitate purification and enhance solubility .

  • Expression conditions: Express in E. coli BL21(DE3) or similar strains at lower temperatures (16-25°C) to improve folding and solubility of membrane proteins.

  • Solubilization strategies:

    • For full-length constructs containing transmembrane domains, use appropriate detergents (DDM, LDAO) for extraction

    • For cytosolic domains, standard purification under native conditions is usually sufficient

  • Purification protocol: Implement a two-step purification using affinity chromatography followed by size exclusion chromatography to ensure high purity.

  • Activity validation: Confirm the functionality of purified constructs through autophosphorylation assays using [γ-32P]ATP.

How can the AtoS-AtoC signaling pathway be monitored in vivo?

Monitoring the AtoS-AtoC signaling pathway in living cells provides crucial insights into its physiological roles and regulation. Several complementary approaches can be employed:

  • Transcriptional reporters: Construct fusions between AtoC-regulated promoters (particularly from the atoDAEB operon) and reporter genes such as lacZ, GFP, or luciferase to quantitatively measure pathway activation .

  • Phosphorylation-specific antibodies: Develop antibodies that specifically recognize the phosphorylated form of AtoC to directly measure pathway activity through western blotting.

  • Protein-protein interaction assays: Use bacterial two-hybrid systems or FRET-based approaches to monitor interactions between AtoS and AtoC under different conditions.

  • Metabolomic analysis: Measure changes in short-chain fatty acid metabolism to indirectly assess pathway activity when modified by genetic or environmental perturbations.

  • RNA-seq analysis: Profile transcriptome changes in response to pathway activation or inhibition to identify the complete regulon controlled by AtoC.

  • Cysteine-crosslinking in vivo: Introduce cysteine residues at strategic positions to monitor conformational changes in AtoS in response to stimuli through crosslinking and western blot analysis .

What methods can be used to identify novel stimuli for the AtoS sensor?

While acetoacetate is the only well-characterized inducer of the AtoS-AtoC system, identifying additional stimuli would enhance our understanding of this pathway's physiological roles. The following methodological approaches are recommended:

  • High-throughput screening: Use reporter strains (containing atoDAEB promoter-reporter fusions) to screen chemical libraries for compounds that activate the pathway.

  • Metabolite profiling: Compare metabolite profiles between wild-type and ΔatoS strains under various growth conditions to identify potential natural ligands.

  • Structural analysis and molecular docking: If structural data becomes available, use computational approaches to predict potential binding molecules.

  • Differential scanning fluorimetry: Monitor thermal stability changes of the purified sensor domain in the presence of potential ligands.

  • Isothermal titration calorimetry (ITC): Directly measure binding interactions between the purified sensor domain and candidate molecules.

  • Mutational analysis: Create sensor domain variants with altered specificity to probe the molecular requirements for stimulus recognition.

How should dose-response curves for AtoS activation be analyzed?

Proper analysis of dose-response relationships for AtoS activation is essential for understanding the system's sensitivity and dynamic range. Based on approaches used with other histidine kinases, the following analytical framework is recommended:

  • Model selection: Apply a semi-empirical three-domain allosteric model that accounts for:

    • Intrinsic conformational preferences of individual domains

    • Coupling strengths between adjacent domains

    • Ligand binding effects on domain equilibria

  • Parameter estimation: Determine key parameters including:

    • EC50 (midpoint of transition)

    • Hill coefficient (cooperativity)

    • Maximum response (upper asymptote)

    • Basal activity (lower asymptote)

  • Comparative analysis: When analyzing mutant variants, focus on three key characteristics:

    • Signal strength at high ligand concentration

    • Signal strength at low ligand concentration

    • Midpoint of the ligand-dependent transition

  • Statistical validation: Apply appropriate statistical tests to determine significant differences between wild-type and mutant responses.

This analytical approach allows for distinguishing between mutations that affect ligand sensitivity versus signaling efficiency, providing insights into structure-function relationships.

What are the common pitfalls in interpreting AtoS phosphorylation data?

Several potential pitfalls must be considered when interpreting AtoS phosphorylation data:

  • Unstable phosphohistidine bonds: The phosphohistidine bond in histidine kinases is labile under acidic conditions, potentially leading to underestimation of phosphorylation levels if inappropriate buffers or gel systems are used.

  • Autophosphatase activity: Many histidine kinases possess intrinsic phosphatase activity that can complicate interpretation of phosphorylation assays, particularly in longer time-course experiments.

  • Non-physiological conditions: In vitro conditions often differ significantly from the cellular environment, potentially altering kinetics and equilibria of phosphorylation reactions.

  • Cross-talk considerations: Possible cross-talk with other two-component systems may confound in vivo results if not properly controlled .

  • Conformational artifacts: Recombinant protein constructs, particularly truncated versions, may adopt non-native conformations that affect activity measurements.

  • Expression level effects: Overexpression of AtoS or AtoC components can saturate the system and mask regulated responses in vivo.

To address these challenges, multiple complementary approaches should be used, and careful controls must be included to validate experimental observations.

How can the AtoS-AtoC system be engineered for synthetic biology applications?

The modular nature of two-component systems makes them attractive candidates for engineering synthetic signaling pathways. Based on principles from synthetic biology, the AtoS-AtoC system could be engineered in several ways:

  • Sensor domain engineering: The sensor domain could be replaced with domains from other histidine kinases to create chimeric proteins responsive to different stimuli.

  • Output specificity modification: The specificity of AtoS for its cognate response regulator could be altered through targeted mutations to create orthogonal signaling pathways.

  • Signal amplification: Introducing mutations that affect the balance between kinase and phosphatase activities could enhance signal amplification properties.

  • Logic gate construction: Combining multiple sensor inputs with engineered phosphorylation networks could create cellular logic gates for complex decision-making.

  • Metabolic pathway regulation: The system could be repurposed to control non-native metabolic pathways by placing them under the control of AtoC-responsive promoters.

These engineering approaches require detailed understanding of domain interfaces and allosteric coupling mechanisms, which can be guided by the three-domain allosteric model described for similar histidine kinases .

What are the implications of cross-talk between AtoS-AtoC and other two-component systems?

Cross-talk between AtoS-AtoC and other two-component systems, particularly EnvZ-OmpR , has significant implications for understanding bacterial signaling networks:

  • Signal integration: Cross-talk allows bacteria to integrate multiple environmental signals through interconnected signaling pathways, potentially enabling more nuanced responses.

  • Regulatory redundancy: Partial functional overlap between systems may provide regulatory redundancy to ensure critical functions are maintained even if one system is compromised.

  • Evolutionary considerations: Cross-talk may represent evolutionary intermediates in the specialization of two-component systems or adaptation mechanisms that allow rapid evolution of new regulatory connections.

  • Therapeutic targeting: Understanding cross-talk mechanisms may reveal vulnerabilities that could be exploited for antimicrobial development, potentially disrupting multiple pathways simultaneously.

  • Predictive modeling challenges: Cross-talk significantly complicates efforts to develop predictive models of bacterial signaling networks, requiring more sophisticated computational approaches.

Future research should systematically map cross-talk interactions and characterize their functional significance using both molecular and systems-level approaches.

How do post-translational modifications beyond phosphorylation affect AtoS function?

While phosphorylation is the primary regulatory mechanism for histidine kinases like AtoS, other post-translational modifications may play important roles in fine-tuning signaling:

  • Acetylation: Lysine acetylation has been identified on multiple bacterial histidine kinases and may affect their activity or interactions.

  • S-glutathionylation: Cysteine residues can undergo S-glutathionylation under oxidative stress conditions, potentially linking redox sensing to histidine kinase function.

  • Nitrosylation: S-nitrosylation of cysteines can occur in response to nitric oxide exposure, potentially regulating kinase activity.

  • Proteolytic processing: Partial proteolysis could generate truncated forms with altered regulatory properties.

  • Protein-protein interactions: Interactions with auxiliary proteins could modulate AtoS activity in response to additional signals.

Investigating these potential regulatory mechanisms requires a combination of proteomic approaches (mass spectrometry to identify modifications), biochemical assays to assess their functional effects, and genetic studies to identify the enzymes responsible for these modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.