Recombinant Escherichia coli Small-conductance mechanosensitive channel (mscS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscS; yggB; b2924; JW2891; Small-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
mscS
Target Protein Sequence
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA
Uniprot No.

Target Background

Function
The mechanosensitive channel of small conductance (MscS) is a protein involved in regulating cellular osmotic pressure. It opens in response to membrane tension without requiring additional proteins. This channel contributes to cellular resistance against hypoosmotic shock. MscS forms an ion channel with approximately 1.0 nanosiemens conductance, exhibiting a slight anion preference. Its activity is voltage-sensitive; depolarization reduces the tension required for channel opening. Channel activity is characterized by short bursts lasting a few seconds.
Gene References Into Functions
  1. Wild-type MscS inactivation was significantly influenced by voltage, inactivating at +60 to +80 mV but not at -60 to +40 mV. PMID: 28101504
  2. Mutations in a conserved domain of E. coli MscS, specifically in the most conserved superfamily residue, resulted in kinetic changes. PMID: 26340270
  3. Molecular dynamics and biophysical analyses demonstrated a reduction in pocket volume and the number of lipid acyl chains within these pockets upon channel opening. PMID: 26551077
  4. Trifluoroethanol (TFE) was shown to affect MscS channel gating kinetics in both spheroplasts and liposomes. PMID: 26116700
  5. MscS protein opens in response to a reduction in intrinsic lipid bilayer pressure. PMID: 25450806
  6. Crystal structures of MscS from E. coli and Helicobacter pylori (solubilized in beta-dodecylmaltoside) were determined at resolutions of 4.4 and 4.2 Å, respectively. PMID: 23339071
  7. This review details the scientific advancements leading to the isolation and identification of MscS, along with its structure-function relationship, focusing on structural and biochemical approaches to understanding channel gating. PMID: 22404681
  8. The MscL/MscS threshold ratio was significantly lower in thinner compared to thicker bilayers. PMID: 22586095
  9. Tension dependencies of inactivation and recovery rates provide insights into the spatial scale of the inactivating transition, guiding models of the inactivated MscS state. PMID: 21670207
  10. F68S and L111S substitutions in MscS caused severe loss-of-function phenotypes in vivo by increasing inactivation rates and promoting ‘silent’ inactivation from the resting state. PMID: 20208543
  11. The crystal structure of MscS does not represent an open state. Gating involves a vapor-lock mechanism where subtle changes in geometry or surface polarity switch between water-filled (conducting) and empty (non-conducting) states. PMID: 15111405
  12. The MscS crystal structure reveals a homoheptamer with three transmembrane segments and a large cytoplasmic domain. PMID: 17500538
  13. Analysis of fluorescence properties in mutant MscS proteins with single Trp residues indicated that W16 and W251 are relatively inaccessible, while W240 is accessible to quenching agents. PMID: 17718516
  14. The transition to a unique mechanosensitive channel state is discussed in the context of existing data. PMID: 18065458
  15. A 3.45 Å resolution structure for MscS in an open conformation is presented. The structure suggests a molecular mechanism underlying MscS gating and its conductivity decay during prolonged activation. PMID: 18755969
  16. Structural rearrangements associated with MscS activation in membranes were determined. The closed-to-open state transition involves downward tilting of the TM1-TM2 hairpin and expansion, tilting, and rotation of the TM3 helices. PMID: 18755978
  17. MscL and MscS serve as valuable models for studying membrane tension-driven conformational transitions in membrane proteins. PMID: 19383606
Database Links
Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular architecture of MscS in E. coli?

MscS is a homoheptameric membrane protein with a distinctive "Japanese lantern" structure consisting of a transmembrane pore and a cytoplasmic "balloon" with seven small openings around its equator . Each of the seven identical subunits contains three transmembrane helices, with the third helix (TM3) lining the pore . The pore-forming sequence, TM3a, has a conserved pattern of alanine and glycine residues at the interface between TM3a helices that is critical for gating properties . X-ray crystallography has enabled visualization of different conformational states, though the crystal structure may not represent a completely open, non-selective channel state .

How does MscS differ from other mechanosensitive channels in E. coli?

E. coli possesses multiple mechanosensitive channels that form a graduated response system to osmotic challenges, as detailed in the table below:

ChannelConductanceActivation ThresholdGene ProductKey Features
MscL~3.0 nSVery high membrane tensionmscLLargest conductance; critical for extreme hypo-osmotic shock survival
MscS~1.0-1.25 nSModerate membrane tensionmscS (YggB)Three TM helices per subunit; central to osmotic survival strategy
MscK~0.875 nSModerate membrane tensionmscK (KefA)Potassium-dependent; shows similarity to MscS in C-terminal region
MscM~0.375 nSLow membrane tensionUnknown (possibly YbdG)Long-lived open states; smallest conductance

These channels gate at different membrane tensions, with more tension required to gate MS channels with larger conductance . The molecular identity of MscM is not definitively established, but recent research suggests YbdG may be a component of MscM channel activity .

What is the physiological significance of MscS in bacterial survival?

MscS plays a central role in the bacterial osmotic stress response system. When E. coli experiences sudden hypo-osmotic shock, water rapidly enters the cell, increasing turgor pressure and membrane tension. MscS opens in response to this tension, functioning as a pressure relief valve by releasing solutes, thus preventing cell lysis .

Experimental evidence demonstrates that mutants lacking both MscS and MscL do not survive extreme hypo-osmotic shock, highlighting their essential protective function . Interestingly, the further loss of MscK in MscL−MscS−MscK− triple mutants does not significantly worsen survival in downshock assays, indicating that MscS is the more critical component of this protective mechanism .

What techniques are most effective for measuring MscS activity?

Patch-clamp electrophysiology remains the gold standard for measuring MscS activity. In this approach, the current flow through channels in a membrane patch at the end of a pipette is measured while applying negative pressure (suction) to generate curvature and associated tension in the patch . This technique allows researchers to observe discrete channel openings and determine key biophysical parameters:

  • Channel conductance (~1.0-1.25 nS for MscS)

  • Tension threshold for activation (moderate compared to MscL)

  • Open probability as a function of applied tension

  • Gating kinetics and ion selectivity

When interpreting patch-clamp data, researchers must consider two key challenges: (1) the applied tension is inferred rather than directly measured, and (2) the relationship between pressure and tension depends on patch geometry, which varies between experiments . To address these variabilities, researchers have developed a method using MscS in native membrane patches as an internal standard for studying MscL mutants, or complementarily, employing MscL as an internal control for characterizing MscK .

How can recombinant MscS be functionally expressed for research?

Researchers have successfully achieved functional expression of recombinant MscS in both bacterial systems and mammalian cell lines. For expression in mammalian cells, the following methodology has proven effective:

  • Transfection into suitable cell lines: CHO and HEK-293 cells have been successfully used, with MscS retaining its biophysical properties in response to increased membrane tension .

  • Verification of functional expression: Excised inside-out patches recorded from MscS-transfected cells display mechanosensitive currents in response to increased negative pressure, similar to those observed in bacterial spheroplasts or liposomes .

  • Confirmation of membrane localization: Live cell staining of tagged constructs (e.g., FLAG-tagged MscS) can verify proper membrane insertion .

The successful functional expression of bacterial mechanosensitive channels in mammalian cells opens new avenues for research, including applications in controlled molecule delivery and complementary analysis techniques .

What experimental designs are suitable for studying MscS mutants?

When investigating MscS mutants to understand structure-function relationships, several experimental designs are appropriate:

  • Independent measures design: Different mutant constructs are tested separately, with randomized allocation to minimize bias . This approach avoids order effects but requires more samples.

  • Repeated measures design: The same membrane patch is subjected to multiple conditions (e.g., different tensions or ionic conditions) to directly compare responses. This reduces variability but may be subject to time-dependent effects .

  • Comparative analysis with internal controls: Using wild-type channels as internal references within the same experimental setup helps normalize for patch-to-patch variability .

For mutation studies, researchers should focus on the conserved Ala-Gly packing in the pore-forming region, as mutations in this area can significantly modify channel gating characteristics . When analyzing the effects of mutations, it's essential to consider potential formation of heteromeric channels or competition for limiting amounts of either lipid or activating molecules .

How can computational approaches enhance MscS research?

Computational methods have become invaluable tools for understanding MscS structure, dynamics, and function. A multi-faceted computational approach includes:

  • All-atom molecular dynamics simulations: Using platforms like NAMD to model 220,000-atom systems for tens of nanoseconds, providing atomic-level insights into channel conformational changes .

  • Coarse-grained modeling: Employing tools such as BioMOCA for longer simulations (100 nanoseconds or more) to capture slower dynamic processes .

  • Restrained molecular dynamics: Incorporating experimental data from EPR measurements to generate models for closed and open conformations of MscS in its native environment .

  • Free energy calculations: Evaluating the energetics of channel gating using the equation where K is the equilibrium constant between closed and open states, and σΔA represents membrane tension's contribution to the free energy of channel opening .

These computational approaches, when integrated with experimental data, have revealed that the structure depicted by X-ray crystallography may not represent a completely open, non-selective channel, leading to refined models of MscS gating mechanisms .

How can MscS be utilized for biotechnological applications?

The unique properties of MscS present several biotechnological opportunities:

  • Controlled delivery of molecules into cells: Following the successful functional expression of E. coli mechanosensitive channels in mammalian cells, researchers can exploit MscS as a controllable portal for delivering small molecules into live cells . This approach could potentially be adapted for targeted drug delivery or cellular manipulation techniques.

  • Osmotic adaptation engineering: Understanding MscS function could inform the development of strains with enhanced osmotic tolerance, which is particularly relevant for industrial fermentation processes where osmotic stress can limit productivity.

  • Antibiotic resistance studies: Recent research has shown that mechanosensitive channels like MscL play significant roles in antibiotic resistance in bacteria such as Actinobacillus pleuropneumoniae . Similar investigations with MscS could provide insights into mechanisms of antibiotic uptake and resistance, potentially contributing to the development of novel antimicrobial strategies.

What factors influence MscS channel clustering and distribution in membranes?

Experimental evidence suggests that mechanosensitive channels may exhibit clustering behavior in membranes. When cytoplasmic membranes are fused with phosphatidylcholine liposomes, individual patches often contain single types of activities rather than mixtures of channels, suggesting clustering in the reconstituted system .

This clustering phenomenon may be influenced by:

  • Specific lipid requirements: Some channel activities may require particular lipids for function or the dilution of inhibitory lipids to allow gating .

  • Protein-protein interactions: Channels may self-associate or interact with other membrane components.

  • Membrane microdomain formation: Lipid rafts or other membrane microdomains may facilitate channel clustering.

Although microarray data indicate transcription of MscS homologs under various conditions, the failure to detect frequent channel activities of other MscS homologs by electrophysiology suggests complex regulation involving specific lipid requirements for activity . The relative ease of detecting MscS, MscL, and MscK activities may result from their abundance and less constrained lipid interactions .

What are the primary challenges in studying MscS homologs?

E. coli contains multiple MscS homologs (YjeP, YbiO, YbdG, YnaI) that share varying degrees of sequence similarity with MscS . Studying these homologs presents several challenges:

  • Expression level variability: The expression of MscS homologs is regulated by complex mechanisms. For example, YbdG expression is inhibited by RpoS, in contrast to the RpoS-dependent expression of MscS, MscL, and YbiO in E. coli .

  • Functional redundancy: The overlapping functions of mechanosensitive channels complicate the interpretation of phenotypes in single-channel mutants.

  • Lipid dependencies: Some MscS homologs may require specific lipid environments for activity, making their functional characterization challenging in standard experimental setups .

  • Heteromeric channel formation: Evidence suggests the possibility of heteromeric channels forming between different subunits. For instance, the YbdG mutant V229A activity is apparently suppressed by coexpression with the wild-type subunit .

These challenges necessitate careful experimental design, including the creation of appropriate genetic backgrounds, optimization of expression conditions, and consideration of membrane composition when studying MscS homologs.

How does the lipid environment affect MscS function?

The lipid environment plays a crucial role in MscS function, affecting:

  • Tension sensing and gating: Membrane composition influences how tension is transmitted to the channel protein and thus affects gating properties .

  • Channel stability and clustering: Specific lipids may promote or inhibit channel clustering, affecting their spatial distribution and cooperative behavior .

  • Conformational dynamics: The interaction between lipids and the channel can impact the energy landscape of conformational transitions between closed and open states.

Methodologically, researchers can investigate lipid-MscS interactions through:

  • Reconstitution of purified MscS into liposomes with defined lipid compositions

  • Molecular dynamics simulations incorporating explicit lipid bilayers

  • Site-directed spin labeling and EPR spectroscopy to detect conformational changes in different lipid environments

Understanding these lipid-protein interactions is essential for developing a complete model of MscS function in its native membrane environment.

What evolutionary insights can be gained from studying MscS across different species?

Members of the MscS family are found in Bacteria, many Archaea, some plants, fungi, and oomycetes , providing rich material for evolutionary studies. Comparative analysis reveals:

  • Conservation of core structural elements: The basic architectural features of MscS are preserved across diverse organisms, suggesting fundamental importance to cellular function.

  • Variation in regulatory domains: Different organisms have evolved specialized regulatory domains that may reflect adaptation to specific environmental niches.

  • Divergence in pore-lining residues: The Ala-Gly pattern in the pore-forming region is not highly conserved across the whole MscS family, suggesting that multiple homologs might encode channels with unique gating properties .

This evolutionary diversity presents opportunities for understanding how mechanosensitive channels have adapted to different cellular contexts and environmental challenges. By comparing MscS homologs across species, researchers can identify conserved functional elements and species-specific adaptations, potentially informing the design of channels with novel properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.