Recombinant Escherichia coli sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Ugp Transporter System

The Ugp system comprises:

  • UgpB: Periplasmic binding protein that captures G3P .

  • UgpA/UgpE: Membrane-spanning permease subunits (UgpA is the focus here) .

  • UgpC: ATP-binding subunit that energizes transport .

Recombinant UgpA forms the transmembrane channel, facilitating G3P import into the cytoplasm. The system is regulated by the pho regulon, which activates under phosphate starvation . Notably, UgpA-deficient strains fail to transport G3P, confirming its essential role .

Expression and Purification

Recombinant UgpA is typically produced in E. coli with high purity (>90%) and yield.

Expression Parameters:

ParameterDetails
Host SystemE. coli (BL21 or similar strains)
TagN-terminal hexahistidine (His-tag)
Purification MethodImmobilized metal affinity chromatography (IMAC)
StorageLyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C

Research Applications

Recombinant UgpA is utilized in diverse studies:

Table 1: Key Research Applications

ApplicationFindings
Membrane Protein DynamicsUgpA-UgpE complexes reconstituted in proteoliposomes exhibit ATPase activity when coupled with UgpB and UgpC .
Phosphate ScavengingDemonstrates role in G3P transport under phosphate starvation, aiding bacterial survival .
Structural StudiesUsed in crystallization trials and topology mapping to resolve ABC transporter mechanisms .
Biotechnological EngineeringEngineered into Shigella and Yersinia strains to study homolog function .

Functional Insights from Mutational Studies

  • Osmotic Sensitivity: The Ugp system is highly sensitive to osmotic shock, indicating periplasmic binding protein dependency .

  • Substrate Specificity: Despite transporting G3P, UgpA does not support growth on G3P as a sole carbon source, highlighting its specialization for phosphate acquisition .

  • Cross-Species Homology: Homologs in Mycobacterium tuberculosis (Rv2835c) and Shigella dysenteriae share 40–60% sequence identity, enabling comparative studies .

Comparative Analysis: Wild-Type vs. Recombinant UgpA

FeatureWild-Type UgpARecombinant UgpA
ExpressionInduced under phosphate starvation Constitutively expressed in E. coli
TaggingNative sequenceHis-tagged for purification
Functional AssaysRequires full UgpBAECQ complex Retains activity in synthetic membranes

Challenges and Future Directions

  • Structural Resolution: Full 3D structure remains unresolved, limiting mechanistic insights .

  • Biotechnological Potential: Could be engineered into synthetic systems for phosphate sensing or biofuel production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ugpA; UTI89_C3959; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Escherichia coli (strain UTI89 / UPEC)
Target Names
ugpA
Target Protein Sequence
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV TLFHDSYYLDAFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugp transport system in E. coli and what role does ugpA play?

The ugp-dependent transport system in E. coli facilitates the uptake of sn-glycerol-3-phosphate and is induced specifically under conditions of phosphate starvation or in mutants constitutive for the pho regulon. The system is characterized by its binding protein-dependent nature, requiring a periplasmic binding protein that interacts with membrane components including the ugpA permease protein. The ugpA protein functions as an integral membrane component of this transport complex, forming part of the transmembrane channel through which sn-glycerol-3-phosphate passes into the cell . This system demonstrates high sensitivity to osmotic shock and does not function in membrane vesicles, further confirming its binding protein-dependent mechanism . The permease protein ugpA works in concert with other components of the transport machinery to facilitate substrate translocation across the membrane.

How is the ugp transport system regulated in E. coli?

The ugp transport system is subject to sophisticated regulatory control that responds primarily to phosphate availability. The system is induced under conditions of phosphate starvation and becomes constitutively expressed in mutants of the pho regulon . This regulatory pattern places the ugp system firmly within the pho regulon, a collection of genes controlled by phosphate availability in the environment. Additionally, research has indicated that the ugp operon can also be induced under carbon starvation conditions, suggesting a more complex regulatory network than initially understood . The system's role in phosphate acquisition becomes particularly important when cells encounter phosphate-limited environments, allowing E. coli to utilize sn-glycerol-3-phosphate as an alternative phosphate source when inorganic phosphate is scarce. This dual regulation by both phosphate and carbon availability reflects the metabolic versatility of E. coli in adapting to various nutrient limitations.

What experimental approaches can be used to detect ugpA expression and function?

Detection of ugpA expression and function can be accomplished through multiple complementary approaches. Transport assays using radiolabeled sn-glycerol-3-phosphate allow quantitative measurement of uptake activity, with [(14)C]sn-glycerol-3-phosphate being particularly useful for tracking incorporation into cellular components such as phospholipids and trichloroacetic acid-precipitable material . Mutant isolation strategies have proven valuable, particularly through selection for resistance against toxic analogs like 3,4-dihydroxybutyl-1-phosphonate that are transported by the ugp system .

For protein expression analysis, researchers can employ:

TechniqueApplicationAdvantages
Western blottingProtein detectionSpecific identification of ugpA protein
qRT-PCRTranscript quantificationSensitive measurement of gene expression
Reporter gene fusionsIn vivo expression monitoringReal-time expression analysis
Membrane fractionationLocalization studiesConfirmation of membrane integration

Functional characterization can be further enhanced through complementation studies in ugpA-deficient strains, demonstrating rescue of transport activity. When working with recombinant systems, researchers should consider using expression vectors with tunable promoters to control expression levels, as high-level overexpression of membrane proteins can be toxic to E. coli host cells .

What expression systems are most effective for recombinant production of ugpA in E. coli?

For optimal ugpA expression, consider implementing:

  • Expression vectors with tightly regulated promoters that minimize leaky expression

  • Lower induction temperatures (16-25°C) to slow protein production and facilitate proper membrane insertion

  • Host strains specifically engineered for membrane protein expression, such as C41(DE3) or C43(DE3)

  • Reduced inducer concentrations (<0.1 mM IPTG) to minimize toxicity effects associated with T7 RNA polymerase overactivity

Recent research suggests that the BL21-AI<gp2> strain offers an innovative approach by decoupling cell growth from recombinant protein production, allowing simultaneous tuning of recombinant protein expression through a phage-derived inhibitor peptide that blocks E. coli RNA polymerase but not T7 RNA polymerase . This system may be particularly valuable for membrane proteins like ugpA where metabolic burden can significantly impact expression outcomes.

How can researchers optimize solubilization and purification of recombinant ugpA?

Membrane protein solubilization and purification present unique challenges compared to soluble proteins. For ugpA, a systematic approach is essential:

First, membrane fraction isolation should be performed following cell disruption by methods such as sonication or French press, followed by differential centrifugation to separate membrane fractions. For solubilization, screening multiple detergents is critical, with mild non-ionic detergents (DDM, LMNG) often proving successful for maintaining protein structure and function. Careful optimization of detergent:protein ratios is essential to prevent protein aggregation while ensuring complete solubilization.

Purification strategies should incorporate:

  • Affinity chromatography using carefully positioned tags (C-terminal tags often perform better than N-terminal for membrane proteins)

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Maintenance of critical detergent concentrations above CMC throughout all purification steps

  • Consideration of lipid supplementation to maintain protein stability

When assessing protein quality, researchers should evaluate not only purity but also functional state, potentially through binding assays with sn-glycerol-3-phosphate or transport assays in reconstituted proteoliposomes. The choice of expression and purification strategy should be guided by the intended downstream applications, whether structural studies, functional characterization, or antibody production.

What are the key considerations for experimental design when studying ugpA functionality in recombinant systems?

When investigating ugpA functionality in recombinant systems, researchers must address several critical experimental design considerations. First, the expression system should recapitulate the native membrane environment as closely as possible, potentially requiring co-expression of other ugp system components like the binding protein. Since the ugp system is naturally induced during phosphate starvation , experiments should carefully control phosphate availability to match the desired study conditions.

Functional studies should incorporate:

  • Transport assays measuring uptake kinetics of sn-glycerol-3-phosphate

  • Binding studies to characterize substrate specificity and affinity

  • Mutational analysis to identify critical residues for transport function

  • Reconstitution experiments in proteoliposomes to demonstrate sufficiency for transport

When designing genetic constructs, researchers should consider that membrane topology and orientation are critical for function. C-terminal tags often interfere less with membrane insertion than N-terminal tags. Additionally, researchers should be aware that high-level overexpression of membrane proteins can trigger stress responses in E. coli, potentially leading to selection for mutants with reduced expression . Monitoring cell morphology and employing lower induction temperatures can help mitigate these effects.

How does the metabolic burden of recombinant ugpA expression affect host physiology and experimental outcomes?

The metabolic burden imposed by recombinant ugpA expression represents a complex phenomenon with significant implications for experimental design and data interpretation. When expressing membrane proteins like ugpA, E. coli cells face multiple challenges: allocation of limited translational resources, management of membrane real estate, and potential toxicity from improperly folded proteins. Research indicates that excessive mRNA production driven by strong promoters like T7 can outcompete endogenous mRNA for ribosomes, impairing synthesis of host proteins essential for cell viability .

This metabolic burden creates selective pressure that may drive unexpected experimental outcomes. For instance, high-level expression of membrane proteins often selects for bacterial subpopulations harboring mutations that reduce or eliminate expression, particularly mutations affecting T7 RNA polymerase activity . This selection process can result in heterogeneous cultures with varying expression levels, complicating data interpretation.

To address these challenges, researchers should:

  • Employ lower inducer concentrations (<0.1 mM IPTG) to reduce toxicity effects

  • Monitor culture heterogeneity through single-colony analysis

  • Consider expression systems that decouple growth from protein production

  • Evaluate the relationship between expression rate and aggregate formation

These strategies help maintain culture homogeneity and improve reproducibility. The contradictory results observed in some studies highlight the need for more systematic experimental approaches to clarify the relationship between metabolic burden, host physiology, and recombinant protein production .

What approaches can be used to study the interaction between ugpA and other components of the ugp transport system?

Investigating protein-protein interactions within membrane transport complexes requires specialized approaches that accommodate the hydrophobic nature of these proteins. For the ugp system, researchers should consider multiple complementary strategies:

TechniqueApplicationLimitations
Bacterial two-hybrid systemsInitial screening of interactionsMay miss weak or context-dependent interactions
Co-immunoprecipitationValidation of interactions in native membraneRequires specific antibodies or tagged constructs
FRET/BRETDynamic interaction studies in living cellsRequires fluorescent protein fusions that may affect function
Crosslinking coupled with mass spectrometryIdentification of interaction interfacesComplex data analysis; potential for artifacts
Reconstitution studiesFunctional validation of interactionsTechnically challenging

Co-expression strategies can provide valuable insights into assembly requirements. By systematically co-expressing different combinations of ugp system components, researchers can determine which proteins are necessary and sufficient for functional transport activity. The binding protein-dependent nature of the ugp system makes it particularly important to include the periplasmic binding protein in interaction studies, as this component is necessary but not sufficient for transport activity .

Recently developed approaches like genetic code expansion allow site-specific incorporation of photo-crosslinkable amino acids, enabling precise mapping of interaction interfaces between ugpA and other transport system components. These techniques can reveal transient interactions that might be missed by traditional approaches.

How do mutations in ugpA affect transport function and what does this reveal about structure-function relationships?

Mutational analysis provides critical insights into the structure-function relationships of the ugpA permease protein. Transport-deficient mutants lacking the binding protein have been successfully isolated through selection for resistance against the toxic analog 3,4-dihydroxybutyl-1-phosphonate , demonstrating the utility of this approach. Systematic mutational studies can further elucidate specific residues essential for substrate recognition, transmembrane channel formation, and interaction with other transport system components.

Key considerations for mutational analysis include:

  • Targeting conserved residues identified through sequence alignment with related transporters

  • Examining predicted transmembrane domains for residues likely to line the substrate pathway

  • Investigating charged residues that may participate in binding protein interactions

  • Employing both alanine-scanning and site-directed mutagenesis approaches

Functional characterization of mutants should assess both transport activity and substrate binding. Transport assays using radiolabeled sn-glycerol-3-phosphate can quantify uptake kinetics, while binding studies can determine whether mutations affect substrate recognition or subsequent translocation steps. Changes in transport kinetics (Km and Vmax) can provide mechanistic insights into how specific residues contribute to the transport process.

Combining mutational data with structural predictions or models can generate testable hypotheses about the three-dimensional organization of the transport system. This integrated approach allows researchers to build a comprehensive understanding of how ugpA structure facilitates its function in sn-glycerol-3-phosphate transport.

How should researchers approach contradictory data when studying ugpA expression and function?

When confronted with contradictory data in ugpA research, investigators should implement a systematic analytical approach. First, thoroughly examine the dataset to identify specific discrepancies and patterns that contradict the initial hypothesis . This involves comparing results with existing literature on the ugp transport system and paying particular attention to outliers that may influence outcomes.

A methodical approach to resolving contradictions includes:

  • Re-evaluating experimental design and assumptions, particularly regarding induction conditions and phosphate availability which directly impact ugp system expression

  • Considering alternative explanations, such as heterogeneity in bacterial populations resulting from selection pressure against high-level membrane protein expression

  • Implementing additional controls to validate key findings, including positive and negative controls for transport activity

  • Refining variable definitions and measurement approaches to ensure consistency

Researchers should recognize that seemingly contradictory results may reflect the complex regulatory network controlling ugpA expression. For instance, the observation that the ugp system can be induced by both phosphate starvation and carbon starvation initially appeared contradictory but ultimately revealed a more sophisticated regulatory mechanism than previously understood.

When analyzing transport activity data, remember that sn-glycerol-3-phosphate transported via the ugp system cannot be used as the sole carbon source but can serve as a phosphate source in the presence of an alternate carbon source . This contextual dependence might explain apparent contradictions in utilization experiments.

What statistical approaches are most appropriate for analyzing ugpA expression and transport activity data?

For transport activity measurements:

  • Standard enzyme kinetics approaches (Lineweaver-Burk, Eadie-Hofstee plots) can characterize transport parameters (Km, Vmax)

  • Time-course experiments should employ regression analysis to determine initial uptake rates

  • Comparative studies between wildtype and mutant transporters should include appropriate statistical tests with corrections for multiple comparisons

  • Power analysis should guide experimental design to ensure sufficient replication

When analyzing incorporation of radiolabeled sn-glycerol-3-phosphate into cellular components, researchers should account for the differential incorporation patterns observed under varying carbon source conditions . This may require multivariate approaches that can distinguish between incorporation into phospholipids versus trichloroacetic acid-precipitable material.

Mixed-effects models can be particularly valuable when analyzing data from experiments where measurements are taken from multiple colonies or cultures over time, allowing researchers to account for both fixed effects (experimental variables) and random effects (biological variability between cultures).

How can researchers distinguish between effects on ugpA expression versus effects on transport activity?

Differentiating between impacts on ugpA expression and effects on transport function requires careful experimental design and multiple complementary approaches. At the most basic level, researchers should implement parallel assays that measure both protein levels and functional activity.

For comprehensive analysis, implement:

MeasurementTechniqueInterpretation
Protein ExpressionWestern blotting, fluorescent taggingQuantifies ugpA protein present in cells
TranscriptionqRT-PCR, reporter fusionsDetermines if effects occur at transcriptional level
Membrane IntegrationSubcellular fractionationConfirms proper localization in membrane
Transport ActivityRadiolabeled substrate uptakeMeasures functional transport capacity
Substrate BindingBinding assays with purified componentsEvaluates substrate recognition independent of transport

When interpreting results, researchers should consider that proportional changes in expression and activity suggest effects primarily on protein production, while disproportionate changes indicate altered specific activity of the transporter. Kinetic analysis comparing Vmax (reflecting transporter abundance) and Km (reflecting substrate affinity) can further distinguish between these possibilities.

It's essential to recognize that conditions affecting ugpA expression may simultaneously impact other components of the transport machinery. Since the ugp system requires a periplasmic binding protein that is necessary but not sufficient for transport activity , expression of this component should be monitored alongside ugpA to ensure comprehensive interpretation.

How might artificial intelligence tools enhance research on ugpA and the ugp transport system?

Artificial intelligence approaches offer promising avenues to address persistent challenges in ugpA research. Machine learning algorithms could help identify patterns in the contradictory experimental results that currently complicate our understanding of metabolic burden and its effects on recombinant protein production . These tools can process diverse datasets to identify complex relationships that might escape traditional analysis.

Specific AI applications with potential impact include:

  • Predictive modeling of membrane protein topology and structure, generating testable hypotheses about ugpA organization

  • Pattern recognition in large-scale mutational data to identify subtle functional relationships

  • Automated literature mining to synthesize findings across diverse studies

  • Optimization algorithms for expression conditions that maximize functional protein yield

The integration of computational and experimental approaches represents a particularly promising direction. For instance, molecular dynamics simulations informed by experimental constraints could reveal dynamic aspects of ugpA function that are difficult to capture through experimental techniques alone. As computational methods continue to advance, their integration with traditional experimental approaches will likely provide unprecedented insights into the structure, function, and regulation of the ugp transport system.

What emerging technologies might advance our understanding of ugpA structure and function?

Several cutting-edge technologies show promise for transforming ugpA research:

  • Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, potentially enabling determination of the ugp transport complex structure without crystallization. This would provide unprecedented insights into the spatial arrangement of ugpA within the functional complex.

  • Advanced microscopy techniques like single-molecule FRET can capture dynamic conformational changes during the transport cycle, revealing mechanistic details of how ugpA facilitates substrate translocation.

  • Nanobody-based approaches offer new tools for stabilizing specific conformational states of transporters, potentially enabling structural studies of transport intermediates that have previously been inaccessible.

  • Genetic code expansion technologies allow site-specific incorporation of non-canonical amino acids into ugpA, enabling precise probing of structure-function relationships through incorporation of photo-crosslinkers, fluorescent amino acids, and chemical handles.

  • Microfluidic systems coupled with single-cell analysis can address the heterogeneity challenges in recombinant expression, allowing researchers to monitor ugpA expression and function at the single-cell level over time.

These technologies, particularly when used in combination, have the potential to overcome longstanding challenges in membrane protein research. By generating more detailed structural and functional information about ugpA and the ugp transport system, these approaches could lead to a comprehensive mechanistic understanding of sn-glycerol-3-phosphate transport in E. coli.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.