Recombinant Escherichia coli Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as per customer requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mdtI; ECSE_1720; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of MdtI in Escherichia coli?

MdtI functions as a critical component of the MdtJI complex, which catalyzes the excretion of spermidine from E. coli cells at neutral pH. Both MdtI and MdtJ are essential for this function, as neither protein alone can effectively export spermidine. The MdtJI complex belongs to the small multidrug resistance (SMR) family of drug exporters and plays a crucial role in maintaining polyamine homeostasis within bacterial cells. When expressed in E. coli strains lacking spermidine acetyltransferase (an enzyme that normally metabolizes excess spermidine), the MdtJI complex significantly enhances cell viability by preventing toxic accumulation of spermidine .

Which specific amino acid residues in MdtI are essential for its function?

Several key amino acid residues in MdtI have been identified as critical for its spermidine export activity. These include Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81. Experimental evidence indicates that these specific residues are directly involved in the excretion activity of the MdtJI complex. This finding suggests that these amino acids either participate in substrate binding, form part of the translocation pathway, or contribute to the structural integrity necessary for proper protein function .

How does the MdtJI complex respond to spermidine levels in E. coli?

Research demonstrates that the MdtJI complex is regulated in response to spermidine levels. Specifically, the expression of mdtJI mRNA increases when cells are exposed to elevated spermidine concentrations. This transcriptional response represents a feedback mechanism that allows the cell to upregulate its spermidine export capacity when faced with potentially toxic accumulation of this polyamine. This regulatory mechanism is part of E. coli's stress response system designed to maintain optimal intracellular polyamine concentrations .

What expression systems are most effective for recombinant production of MdtI?

  • Specialized E. coli strains engineered for membrane protein expression (C41(DE3), C43(DE3))

  • Low-copy number plasmids with tunable promoters

  • Reduced induction temperatures (16-25°C) to facilitate proper folding

  • Fusion partners that enhance solubility

  • Codon optimization based on the expression host

These approaches can significantly improve the yield of properly folded, functional MdtI protein for further studies .

What are the most effective methods to assess the functionality of recombinant MdtI?

To evaluate whether recombinantly expressed MdtI is functional, researchers should employ multiple complementary approaches:

  • Spermidine toxicity rescue assays: Transform MdtI expression constructs into spermidine acetyltransferase-deficient E. coli strains (such as CAG2242) and measure growth recovery in the presence of high spermidine concentrations (12 mM) .

  • Radioisotope-based export assays: Measure the excretion of [14C]spermidine from cells expressing MdtI compared to control cells. This approach provides direct quantitative evidence of transport activity .

  • Polyamine content analysis: Quantify intracellular spermidine levels in cells with and without MdtI expression after exposure to exogenous spermidine. A functional MdtI-MdtJ complex will result in significantly reduced intracellular spermidine accumulation .

  • Site-directed mutagenesis: Verify the importance of key residues (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) by creating point mutations and assessing their impact on transport activity .

How should researchers design experiments to investigate MdtI-MdtJ interaction?

Investigating the interaction between MdtI and MdtJ requires careful experimental design that accounts for their membrane-embedded nature. A comprehensive approach should include:

  • Co-expression systems: Design constructs that allow simultaneous expression of both proteins, potentially with different affinity tags for co-purification studies.

  • Bacterial two-hybrid or split-ubiquitin assays: These systems are specifically designed to detect membrane protein interactions in vivo.

  • FRET (Förster Resonance Energy Transfer): Tag MdtI and MdtJ with appropriate fluorophores to monitor their proximity and interaction in living cells.

  • Cross-linking followed by mass spectrometry: Use chemical cross-linkers to capture the interacting complex, followed by proteomic analysis to identify interaction interfaces.

  • Co-immunoprecipitation with membrane-appropriate detergents: Preserve protein interactions during solubilization by screening multiple detergent conditions.

These methods should be applied in combination to build a comprehensive understanding of how MdtI and MdtJ interact to form a functional spermidine export complex .

What controls are essential when studying spermidine export mediated by MdtI?

Rigorous control experiments are crucial for accurate interpretation of MdtI function studies:

  • Empty vector controls: Cells transformed with expression vector lacking the mdtI gene to establish baseline spermidine accumulation and excretion.

  • Single protein controls: Expression of MdtI or MdtJ alone to demonstrate the requirement for both proteins in forming a functional complex.

  • Substrate specificity controls: Include other polyamines (putrescine, cadaverine) to determine export specificity.

  • Mutant variants: Include non-functional MdtI mutants (e.g., mutations in Glu 5, Glu 19, Asp 60, Trp 68, or Trp 81) as negative controls.

  • Positive controls: Include known functional polyamine transporters with characterized activity profiles.

  • pH controls: Since polyamine transport can be pH-dependent, ensure experiments at neutral pH to specifically evaluate MdtJI function under physiological conditions .

What analytical techniques provide the most reliable quantification of spermidine export?

Several analytical approaches can be employed to quantify spermidine export with different advantages:

  • Radioisotope tracing: Using [14C]spermidine allows highly sensitive detection of spermidine movement across the membrane. Data from experimental studies showed clear differences in spermidine export between cells expressing MdtJI and control cells after 40 minutes of incubation .

  • HPLC (High-Performance Liquid Chromatography): Provides precise quantification of polyamine levels in both cell lysates and culture supernatants. This method allows researchers to directly measure the reduction in intracellular spermidine levels and corresponding increase in extracellular spermidine.

  • LC-MS/MS (Liquid Chromatography-Tandem Mass Spectrometry): Offers superior sensitivity and specificity for polyamine detection and can distinguish between different polyamines and their derivatives.

  • Fluorescent polyamine analogs: Allow real-time visualization of polyamine transport in living cells without disrupting cellular structures.

Each method has specific strengths, and combining multiple approaches provides more robust data interpretation.

How can researchers troubleshoot common challenges in MdtI functional studies?

When investigating MdtI function, researchers frequently encounter several challenges that can be addressed through systematic troubleshooting:

  • Low expression levels:

    • Optimize codon usage for E. coli

    • Test different promoter strengths

    • Explore various E. coli expression strains

    • Consider fusion partners that enhance expression

  • Inclusion body formation:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Include chemical chaperones in the growth medium

    • Use specialized detergents for extraction

  • No detectable transport activity:

    • Verify that both MdtI and MdtJ are expressed

    • Ensure proper membrane integration

    • Check substrate concentration range

    • Validate assay sensitivity with positive controls

    • Extend measurement time points to capture slower transport kinetics

How might MdtI structure-function studies contribute to drug development strategies?

Understanding the structural basis of MdtI function could inform novel antimicrobial development through several mechanisms:

  • Targeting polyamine homeostasis: Since the MdtJI complex is crucial for maintaining non-toxic levels of spermidine, compounds that inhibit this export system could potentially lead to toxic polyamine accumulation in bacterial cells.

  • Expanding antimicrobial resistance knowledge: As a member of the SMR family, insights from MdtI structure-function studies might reveal common mechanisms used by bacteria to export toxic compounds, including antibiotics.

  • Structure-based drug design: Detailed structural information about the substrate binding pocket of MdtI could enable rational design of molecules that selectively inhibit bacterial polyamine transport without affecting mammalian transporters.

  • Combination therapy approaches: Inhibitors of MdtI might sensitize bacteria to existing antibiotics or to naturally occurring polyamines present in infection sites .

What are the latest methodological advances for studying MdtI regulation at the transcriptional level?

Recent technological developments have expanded the toolkit for investigating MdtI regulation:

  • RNA-seq and ribosome profiling: These techniques allow comprehensive analysis of mdtI transcription and translation responses to various environmental conditions, including different polyamine concentrations.

  • ChIP-seq (Chromatin Immunoprecipitation Sequencing): Helps identify transcription factors that bind to the mdtJI promoter region, elucidating the regulatory network controlling expression.

  • CRISPR interference (CRISPRi): Enables precise modulation of mdtI expression levels without permanently altering the genome, allowing for temporal studies of regulation.

  • Single-cell analysis: Techniques such as single-cell RNA-seq and fluorescent reporters permit investigation of cell-to-cell variability in mdtI expression and potential bet-hedging strategies in bacterial populations.

  • Biosensors: Development of polyamine-responsive biosensors allows real-time monitoring of intracellular polyamine levels and correlation with mdtI expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.