Recombinant Escherichia coli Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Introduction

The Escherichia coli spermidine export protein MdtJ is part of the MdtJI protein complex, which plays a crucial role in spermidine excretion and in alleviating spermidine toxicity in E. coli . Polyamines, including putrescine, spermidine, and spermine, are essential for normal cell growth, and their levels are tightly regulated through biosynthesis, degradation, uptake, and excretion .

MdtJI Protein Complex

The MdtJI protein complex is identified as a major spermidine excretor in E. coli . Both MdtJ and MdtI are necessary for the recovery from the toxicity of over-accumulated spermidine . The level of mdtJI mRNA is increased by spermidine, which likely enhances the transcription of mdtJI mRNA, contributing to the relief of toxicity caused by spermidine overaccumulation .

Functional Analysis

To identify proteins involved in spermidine excretion, researchers examined 33 putative drug exporters in an E. coli strain deficient in spermidine acetyltransferase, an enzyme that metabolizes spermidine . The toxicity and inhibition of cell growth caused by spermidine overaccumulation were recovered in cells transformed with pUC mdtJI or pMW mdtJI, which encode MdtJ and MdtI, belonging to the small multidrug resistance family of drug exporters .

Impact on Cell Viability

When the mdtJI gene was transformed into E. coli CAG2242, cell viability during culture with 2 mM spermidine significantly increased . In contrast, transforming genes for other drug transporters did not significantly increase the viability of E. coli CAG2242 . Neither mdtJ nor mdtI alone significantly increased cell viability, indicating that both MdtJ and MdtI proteins are required to rescue cell viability during culture with spermidine .

Spermidine Excretion Activity

Experiments with E. coli CAG2242, cultured with or without 2 mM spermidine, showed overaccumulation of spermidine in cells cultured with spermidine . When mdtJI was transformed into E. coli CAG2242, the accumulation of spermidine was greatly diminished, which paralleled the recovery of cell viability . Excretion of accumulated [¹⁴C]spermidine was observed in cells transformed with pUC mdtJI . The level of spermidine in the reaction mixture increased significantly when pUC mdtJI was transformed into cells, confirming that MdtJI can catalyze the excretion of spermidine .

Key Amino Acid Residues

Specific amino acid residues in MdtJ and MdtI are involved in the excretion activity of MdtJI :

  • MdtJ: Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82

  • MdtI: Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81

Role in Spermidine Transport

MdtJI enhances cell viability and growth by excreting spermidine when it overaccumulates in cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtJ; ECSE_1721; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Spermidine Export Protein MdtJ and how was it identified?

MdtJ is a component of a spermidine excretion protein complex (MdtJI) in Escherichia coli that functions to export spermidine from the cell. This protein was identified through a systematic screening approach examining 33 putative drug exporters in E. coli. The identification process involved testing each candidate's ability to rescue an E. coli strain (CAG2242) deficient in spermidine acetyltransferase from the toxicity caused by spermidine overaccumulation. Among all candidates tested, only the MdtJI complex demonstrated significant rescue effects, increasing cell viability by more than 1,000-fold when cultured in the presence of 2 mM spermidine .

The research methodology employed to identify MdtJ involved:

  • Transforming spermidine acetyltransferase-deficient E. coli with genes encoding potential exporters

  • Measuring cell viability during culture with high spermidine concentrations

  • Confirming specificity by comparing growth rates with and without spermidine

  • Validating results using both high-copy (pUC119) and low-copy number (pMW119) vectors

What is the relationship between MdtJ and MdtI in the spermidine export complex?

MdtJ and MdtI function as an obligate heteromeric complex; neither protein alone is sufficient for spermidine export activity. Experimental data clearly demonstrates that both proteins must be co-expressed to confer resistance to spermidine toxicity in E. coli. When either mdtJ or mdtI was transformed alone, cell viability of E. coli CAG2242 did not increase significantly in the presence of 2 mM spermidine. This indicates that both components are essential for forming a functional spermidine export complex .

The functional interdependence suggests a structural arrangement where both proteins contribute to forming the active transport channel or binding site for spermidine. This heteromeric complex formation is characteristic of other members of the small multidrug resistance family of transporters to which MdtJ and MdtI belong .

Which specific amino acid residues in MdtJ are crucial for its function?

Site-directed mutagenesis studies have identified several critical amino acid residues in MdtJ that are essential for the excretion activity of the MdtJI complex. The following residues were found to be involved in the spermidine export function:

Key functional residues in MdtJ:

  • Tyr4

  • Trp5

  • Glu15

  • Tyr45

  • Tyr61

  • Glu82

The prevalence of aromatic (Tyr, Trp) and acidic (Glu) residues suggests that these amino acids likely participate in substrate recognition through cation-π interactions or electrostatic interactions with the positively charged spermidine molecule. This pattern of functional residues provides insight into the molecular mechanism of spermidine binding and transport by the MdtJI complex .

How is the expression of mdtJI regulated in E. coli?

The mdtJ and mdtI genes are co-expressed in E. coli, suggesting they form an operon. Research has demonstrated that the level of mdtJI mRNA is increased by spermidine, indicating a substrate-induced regulatory mechanism. This represents a feedback regulation system where the substrate of the transporter (spermidine) enhances the expression of its own export machinery .

This type of regulation is physiologically relevant as it allows the cell to respond to increasing intracellular spermidine concentrations by upregulating the export mechanism, thereby maintaining spermidine homeostasis and preventing toxic accumulation. The molecular details of this regulation, including potential transcription factors or regulatory elements in the mdtJI promoter region, represent an important area for further investigation .

What experimental designs are most effective for studying MdtJ function in vivo?

Effective experimental designs for studying MdtJ function in vivo typically employ the following approaches:

Genetic complementation assays

  • Use of spermidine acetyltransferase-deficient E. coli strains (e.g., E. coli CAG2242)

  • Transformation with expression vectors containing mdtJ and mdtI genes

  • Growth assessment in media containing varying concentrations of spermidine (2-12 mM)

  • Measurement of cell viability using standard microbiological techniques

Radioactive spermidine transport assays

  • Loading cells with [14C]spermidine

  • Measuring excretion rates in different genetic backgrounds

  • Comparing wild-type and mutant MdtJ variants

  • Analysis of time-dependent spermidine efflux

Intracellular polyamine content analysis

  • HPLC-based quantification of spermidine and other polyamines

  • Comparison between control cells and those expressing MdtJI

  • Assessment of changes in polyamine content under various growth conditions

  • Example data is shown in Table 1:

StrainCulture conditionsSpermidine content (nmol/mg protein)Putrescine content (nmol/mg protein)
E. coli CAG2242No spermidine5.2 ± 0.331.5 ± 1.8
E. coli CAG22422 mM spermidine78.6 ± 3.529.6 ± 1.5
E. coli CAG2242 + pUC mdtJI2 mM spermidine12.3 ± 0.732.1 ± 1.9

Table 1: Example data showing the effect of MdtJI expression on polyamine content in E. coli CAG2242 cultured with or without exogenous spermidine. The expression of MdtJI significantly reduces intracellular spermidine accumulation without affecting putrescine levels.

These experimental approaches provide complementary information about MdtJ function, from its effects on cell physiology to its direct transport activity .

What expression systems are optimal for recombinant production of MdtJ?

Several expression systems can be used for the recombinant production of MdtJ protein, each with specific advantages:

E. coli expression systems

  • Highest yields and shortest turnaround times

  • Most suitable for biochemical and structural studies requiring large protein quantities

  • Can be optimized using different promoters (T7, tac) and fusion tags (His, GST, MBP)

  • May require optimization of membrane protein expression conditions (temperature, inducer concentration)

Yeast expression systems

  • Good yields with eukaryotic post-translational modifications

  • Alternative for cases where E. coli expression is problematic

  • Suitable for scaled-up production

  • May provide better protein folding than E. coli

Higher eukaryotic systems

  • Insect cells with baculovirus vectors: provide many post-translational modifications necessary for correct protein folding

  • Mammalian cells: can retain complete activity but with lower yields

  • More complex and time-consuming than prokaryotic systems

For membrane proteins like MdtJ, expression optimization typically involves:

  • Testing multiple fusion tags and their positions (N vs. C terminal)

  • Screening various detergents for membrane protein solubilization

  • Optimizing induction conditions (temperature often lowered to 16-20°C)

  • Co-expression with MdtI to facilitate proper complex formation and stability

The choice of expression system should be guided by the specific research requirements and downstream applications .

How can site-directed mutagenesis be utilized to further understand MdtJ structure-function relationships?

Site-directed mutagenesis has proven valuable for elucidating the structure-function relationships of MdtJ. A methodological approach to utilizing this technique includes:

Rational selection of target residues

  • Conserved residues identified by sequence alignment with other small multidrug resistance family proteins

  • Charged and aromatic residues potentially involved in substrate binding (Tyr, Trp, Glu, Asp)

  • Residues predicted to line the transport channel based on computational models

  • Positions identified in the MdtJ primary sequence: Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82

Mutagenesis strategy

  • Conservative substitutions (e.g., Tyr→Phe, Glu→Asp) to test specific chemical properties

  • Non-conservative substitutions (e.g., Tyr→Ala, Glu→Gln) to ablate function

  • Creation of multiple mutants to test cooperative effects

Functional assessment

  • Complementation assays in spermidine acetyltransferase-deficient E. coli

  • Measurement of spermidine transport rates using radioactively labeled substrates

  • Determination of binding affinities using purified mutant proteins

  • Assessment of complex formation between MdtJ mutants and wild-type MdtI

This approach has already identified six residues in MdtJ that are critical for function, suggesting that these amino acids may participate in spermidine recognition or the transport mechanism. Further mutagenesis studies could help map the complete spermidine binding site and transport pathway through the MdtJI complex .

What experimental approaches can resolve contradictions in the literature regarding MdtJ's mechanism of action?

While the literature broadly agrees on MdtJ's function as part of a spermidine export complex, there may be contradictions or knowledge gaps regarding its precise mechanism of action. These can be addressed through:

Biochemical characterization of purified MdtJI complex

  • Reconstitution in proteoliposomes to measure transport activity directly

  • Determination of substrate specificity and transport kinetics

  • Measurement of ion coupling (H+, Na+) and electrogenicity of transport

  • Comparison with other polyamine transporters to identify mechanistic differences

Structural biology approaches

  • X-ray crystallography of the MdtJI complex with and without bound spermidine

  • Cryo-electron microscopy to determine the 3D structure in different conformational states

  • Molecular dynamics simulations to model the transport cycle

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Advanced genetic approaches

  • CRISPR-Cas9 genome editing to study MdtJ in its native genomic context

  • Suppressor mutation analysis to identify functional interactions

  • Construction of chimeric transporters to map functional domains

  • Directed evolution to generate MdtJ variants with altered specificity

Systems biology approaches

  • Transcriptomics to identify genes co-regulated with mdtJI

  • Metabolomics to assess global changes in polyamine metabolism

  • Protein-protein interaction networks to identify additional components

  • Computational modeling of polyamine homeostasis including MdtJI function

By integrating data from these complementary approaches, researchers can develop a more complete and consistent model of MdtJ's mechanism of action .

What analytical techniques provide the most insight into MdtJ-MdtI interactions?

Understanding the interactions between MdtJ and MdtI requires sophisticated analytical techniques:

Biophysical methods for protein-protein interactions

  • Fluorescence resonance energy transfer (FRET) between tagged MdtJ and MdtI

  • Biolayer interferometry to measure binding kinetics

  • Isothermal titration calorimetry to determine thermodynamic parameters

  • Size-exclusion chromatography coupled with multi-angle light scattering to determine complex stoichiometry

Cross-linking coupled with mass spectrometry

  • Chemical cross-linking to capture interaction interfaces

  • Photo-crosslinking with unnatural amino acids for site-specific analysis

  • Mass spectrometry identification of cross-linked peptides

  • Mapping of interaction sites to generate structural models

Co-purification strategies

  • Tandem affinity purification with tags on both proteins

  • Split-tag approaches to ensure isolation of intact complexes

  • Native PAGE analysis of complex formation

  • Analytical ultracentrifugation to determine complex homogeneity

Functional complementation between mutants

  • Testing combinations of MdtJ and MdtI mutants for functional rescue

  • Second-site suppressor mutation analysis

  • Domain swapping between MdtJ and related transporters

  • Assessing the impact of mutations on complex stability versus activity

These techniques can help determine the stoichiometry, interaction interfaces, and conformational changes involved in MdtJ-MdtI complex formation and function .

How can experimental design in randomized block designs (RBD) be applied to MdtJ research?

When studying complex biological systems like the MdtJ transport protein, experimental variability can obscure true effects. Randomized block design (RBD) offers a powerful statistical approach to enhance experimental precision:

Application of RBD principles to MdtJ functional studies

B. Example RBD for MdtJ mutant analysis
A study comparing the transport activity of wild-type MdtJ and three mutants (Y4A, W5A, E15A) could be designed as follows:

Block (Day)Treatment 1 (WT)Treatment 2 (Y4A)Treatment 3 (W5A)Treatment 4 (E15A)
18912815
29210917
39011714
49413816

Table 2: Example of a randomized block design for MdtJ mutant analysis. Values represent hypothetical spermidine export activity (% of control).

ANOVA table for RBD analysis

Source of VariationSSDFMSF
TreatmentsSS<sub>tr</sub>a-1MS<sub>tr</sub>MS<sub>tr</sub>/MS<sub>E</sub>
BlocksSS<sub>bl</sub>b-1MS<sub>bl</sub>MS<sub>bl</sub>/MS<sub>E</sub>
ErrorSS<sub>E</sub>(a-1)(b-1)MS<sub>E</sub>
TotalSS<sub>T</sub>ab-1

Table 3: ANOVA table structure for analyzing RBD experiments in MdtJ research .

This statistical approach allows researchers to account for day-to-day or batch-to-batch variability while precisely measuring the effects of mutations on MdtJ function. Similar designs can be applied to drug screening, substrate specificity studies, or comparing expression systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.