Recombinant Escherichia coli Spermidine/putrescine transport system permease protein PotB (potB)

Shipped with Ice Packs
In Stock

Description

Functional Insights

PotB facilitates polyamine transport through coordinated interactions:

  • Substrate binding: Collaborates with PotD (substrate-binding protein) to capture spermidine/putrescine in the periplasm .

  • ATPase coupling: Conformational changes in PotB induced by spermidine binding activate PotA’s ATPase activity, driving substrate translocation .

  • Ion channel regulation: Structural studies reveal that deletions in PotB’s periplasmic linker region (e.g., Δ41–91) impair function, but suppressor mutations (e.g., R109P) restore Na+-driven motility by altering transmembrane helix arrangements .

Biochemical Properties of Recombinant PotB

Recombinant PotB is produced in E. coli with an N-terminal His tag, enabling high-purity isolation (>90% by SDS-PAGE) . Key specifications include:

Research Applications

  • Mechanistic studies: Used to investigate ABC transporter dynamics, including ATPase coupling and substrate recognition .

  • Structural biology: Cryo-EM structures of the PotABC complex (e.g., EMD-38933) reveal conformational states during transport .

  • Drug discovery: Insights into PotB’s role in bacterial survival inform antibiotic development targeting polyamine uptake .

Mutational Analysis and Functional Impact

Site-directed mutagenesis highlights residues critical for PotB’s activity:

  • Trp46, Asp108, and Asp199 in PotC: Cooperate with PotB for spermidine recognition .

  • PotBΔL (Δ41–91): Nonfunctional permease unless rescued by R109P mutation, which restores Na+-driven motility .

Table 3: Functional Impact of PotB Mutations

MutationEffect
PotBΔL (Δ41–91)Loss of motility; requires R109P suppressor for function
R109P in PotBΔLRestores Na+-dependent stator assembly
Trp8AlaDisrupts PotB/PotC membrane insertion

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
potB; b1125; JW1111; Spermidine/putrescine transport system permease protein PotB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
potB
Target Protein Sequence
MIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLN MALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYL NEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGAS KLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDW PFGAATSITLTIVMGLMLLVYWRASRLLNKKVELE
Uniprot No.

Target Background

Function
Essential for the activity of the bacterial periplasmic transport system responsible for transporting putrescine and spermidine.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of PotB in E. coli?

PotB functions as a transmembrane component of the spermidine-preferential ABC transporter system in E. coli. It forms part of the PotD-PotABC complex, which belongs to the adenosine triphosphate-binding cassette (ABC) transporter family . Structurally, PotB contains multiple transmembrane domains that create a translocation pathway for polyamines across the bacterial membrane.

Recent structural studies have revealed that PotB contains specific "gating" residues (F222, Y223, D226, and K241) that play crucial roles in controlling spermidine uptake . These residues undergo conformational changes during the transport cycle to facilitate substrate movement from the periplasmic side to the cytoplasmic side of the membrane.

PotB works in concert with PotC (another transmembrane protein), PotA (the ATP-binding protein), and PotD (the periplasmic substrate-binding protein) to form a functional transport complex. This complex can adopt different conformational states, including distinct "inward-facing" and "outward-facing" configurations, which are essential for the alternating access mechanism of transport .

How does PotB interact with other components of the spermidine/putrescine transport system?

PotB forms an integral part of the transmembrane domain (TMD) of the PotD-PotABC complex, directly partnering with PotC to create the substrate translocation pathway. In E. coli, this spermidine-preferential uptake system consists of a periplasmic substrate-binding protein (PotD), two transmembrane proteins (PotB and PotC), and a membrane-associated ATPase (PotA) .

When PotD binds spermidine in the periplasm, it docks onto the PotB-PotC complex, initiating a series of conformational changes. The interaction between PotB and PotA couples ATP hydrolysis to substrate translocation, with ATP binding to PotA inducing conformational changes that are transmitted to PotB .

During the transport cycle, the interactions between PotB and other components undergo significant rearrangements. In the "pretranslocation state," PotD interacts with specific regions of PotB while delivering the substrate. As the system transitions to the "translocation intermediate state," these interactions change, with new contacts being established and others being disrupted . The scoop loop (periplasmic loop P3, residues 198-228) in PotC protrudes into the PotD binding pocket, playing a key role in substrate transfer from PotD to the translocation pathway .

What are the key residues in PotB involved in spermidine uptake?

Several critical residues in PotB have been identified as essential for spermidine transport:

  • The "gating" residues F222, Y223, D226, and K241 control substrate passage through the transmembrane domain .

  • S113 and F164 in PotB are implicated in spermidine binding within the translocation pathway .

These residues were identified through structural studies capturing the PotD-PotABC complex in different conformational states. Y223 appears to be strategically positioned within the translocation pathway, where it can directly interact with the spermidine substrate.

Functional studies have shown that mutations in these key residues can significantly impact transport activity. For example, alterations in the aromatic residues (F222, Y223) can disrupt the hydrophobic interactions with the methylene groups of polyamines, while changes to charged residues (D226, K241) can affect electrostatic interactions with the positively charged amino groups of the substrate .

How is the expression of recombinant PotB optimized in different host systems?

Optimizing recombinant PotB expression requires careful consideration of host systems and expression strategies:

E. coli Expression Systems:

  • Traditionally the most widely used host (approximately 60% of recombinant genes)

  • Specialized strains like C41(DE3) or C43(DE3) are designed specifically for membrane protein expression

  • Tunable promoters (e.g., arabinose-inducible) can control expression levels to prevent toxicity

  • Fusion partners like MBP or SUMO can enhance solubility

Yeast Expression Systems:

  • Saccharomyces cerevisiae offers extensive genetic tools for optimization despite being underutilized

  • Pichia pastoris has shown steadily increasing usage for recombinant protein expression since 1995

  • Higher eukaryotic machinery provides more sophisticated membrane insertion capabilities

  • Capable of achieving high cell density cultivation, increasing potential yields

Innovative Approaches:

  • Vesicle-packaged recombinant protein production using a simple peptide tag (VNp) exports proteins in membrane-bound vesicles from E. coli

  • This system compartmentalizes proteins within a micro-environment that supports proper folding

  • Particularly valuable for membrane proteins that may be toxic when overexpressed

  • Allows for high yields and efficient downstream processing

Host SystemAdvantagesLimitationsBest For
E. coliRapid growth, high yields, extensive genetic toolsLimited post-translational modificationsBasic structural studies, high-throughput screening
S. cerevisiaeSophisticated folding machinery, extensive genetic toolsLower yields than P. pastorisChallenging membrane proteins requiring specific folding
P. pastorisHigh biomass yields, strong inducible promotersLonger cultivation timeLarge-scale production, proteins requiring eukaryotic processing
Vesicle systemCompartmentalization, reduced toxicityRelatively new technologyToxic proteins, disulfide-bond containing proteins

What structural changes occur in PotB during the transition between "inward-facing" and "outward-facing" conformations?

Cryo-electron microscopy (cryo-EM) studies have revealed significant conformational changes in PotB during the transport cycle. The PotD-PotABC complex adopts distinct "inward-facing" and "outward-facing" conformations, with major rearrangements in the transmembrane domains formed by PotB and PotC .

In the "outward-facing" conformation, PotB's transmembrane helices create a pathway open to the periplasmic side but closed to the cytoplasmic side. This arrangement allows the substrate (spermidine) to enter the translocation pathway from PotD. During the transport cycle, ATP binding and hydrolysis by PotA trigger conformational changes that are transmitted to PotB, rearranging its transmembrane helices to form the "inward-facing" conformation where the pathway opens to the cytoplasmic side while closing to the periplasmic side .

The "gating" residues in PotB (F222, Y223, D226, and K241) are central to these conformational transitions, moving to either facilitate or block substrate passage at different stages of the transport cycle . Structural analyses have also revealed the formation of a large cavity (approximately 200 ų) within the PotBC complex during certain conformational states, which likely accommodates the spermidine substrate during translocation .

How can site-directed mutagenesis be used to study structure-function relationships in PotB?

Site-directed mutagenesis provides a powerful approach for investigating structure-function relationships in PotB through systematic modification of specific residues:

Strategic Target Selection:

  • The gating residues (F222, Y223, D226, and K241) are primary targets as they control substrate passage

  • Residues involved in spermidine binding (S113, F164) help investigate substrate specificity

  • Interface residues between PotB and other components reveal assembly mechanisms

Effective Mutation Strategies:

  • Conservative substitutions that maintain chemical properties (e.g., Phe to Tyr)

  • Non-conservative changes that alter properties (e.g., charged to hydrophobic)

  • Alanine scanning to systematically neutralize side chain contributions

  • Introduction of cysteine residues for subsequent labeling or cross-linking studies

Comprehensive Functional Analysis:

  • Transport assays to measure kinetic parameters (Km, Vmax)

  • ATP hydrolysis assays to assess coupling efficiency

  • Binding studies to determine effects on substrate affinity

  • Structural studies to correlate functional changes with structural alterations

A systematic mutagenesis approach for PotB should include:

  • Creating a panel of single amino acid substitutions at key positions

  • Expressing and purifying each mutant protein

  • Reconstituting the mutant proteins with wild-type versions of other complex components

  • Measuring transport activity, substrate binding, and ATP hydrolysis

  • Correlating functional changes with the specific roles of the mutated residues

What experimental approaches are most effective for studying PotB-substrate interactions?

Multiple experimental approaches can be combined to comprehensively study PotB-substrate interactions:

Structural Methods:

  • Cryo-EM to capture different conformational states of the PotD-PotABC complex

  • X-ray crystallography of individual components or the entire complex

  • Nuclear magnetic resonance (NMR) spectroscopy for dynamic interactions

Binding Assays:

  • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Fluorescence-based assays using environment-sensitive probes

Functional Assays:

  • Radiolabeled substrate uptake in reconstituted systems

  • Fluorescence-based transport assays in proteoliposomes

  • Electrophysiological measurements in planar lipid bilayers

Computational Methods:

  • Molecular dynamics simulations to model substrate passage

  • Docking studies to predict binding modes

  • Quantum mechanical calculations for detailed interaction energetics

Particularly valuable insights have come from combining structural studies with functional assays. For example, cryo-EM structures of the PotD-PotABC complex in different conformational states have revealed how the substrate-binding site changes during the transport cycle, providing a framework for designing targeted functional studies .

How does the mechanism of PotB function compare to other bacterial polyamine transporters?

In E. coli, three different polyamine transport systems have been identified, with distinct mechanisms and specificities:

ABC Transporters (Including PotB):

  • Two uptake systems: the putrescine-specific system and the spermidine-preferential system (including PotB)

  • Both are ABC transporters consisting of a periplasmic substrate-binding protein, two transmembrane proteins, and a membrane-associated ATPase

  • Utilize ATP hydrolysis to drive active transport against concentration gradients

  • The crystal structures of the substrate-binding proteins (PotD and PotF) reveal a binding site in a cleft between two domains

PotE System:

  • Mediates both uptake and excretion of putrescine

  • Uptake is dependent on membrane potential

  • Excretion involves an exchange reaction between putrescine and ornithine

  • Functions as a secondary transporter rather than an ABC transporter

The PotB-containing spermidine-preferential system differs from the putrescine-specific system primarily in substrate specificity, determined by the arrangement of acidic residues in the binding pocket. In both systems, polyamines are mainly recognized by aspartic acid and glutamic acid residues, which interact with the NH2 (or NH) groups, and by tryptophan and tyrosine residues that have hydrophobic interactions with the methylene groups of polyamines .

Compared to eukaryotic transporters like TPO1 in Saccharomyces cerevisiae (located on the vacuolar membrane), the bacterial PotB system shows some functional similarities but operates as part of a more complex multi-component assembly .

What challenges exist in the structural determination of PotB and how can they be overcome?

Membrane proteins like PotB present significant challenges for structural studies, with distinct obstacles associated with different methodologies:

Challenges in X-ray Crystallography:

  • Obtaining well-diffracting crystals of membrane proteins is exceptionally difficult

  • Detergent micelles used to solubilize membrane proteins can hinder crystal contacts

  • Membrane proteins often have conformational heterogeneity, complicating crystallization

  • The hydrophobic nature of transmembrane domains can lead to protein aggregation

Challenges in Cryo-EM:

  • The relatively small size of individual components like PotB limits resolution

  • Conformational heterogeneity can complicate image processing

  • Detergent micelles create background noise that reduces contrast

  • The complex may adopt preferred orientations on cryo-EM grids

Effective Strategies to Overcome These Challenges:

  • Expression and Purification Optimization:

    • Use of specialized expression systems like the vesicle-packaged recombinant protein production system

    • Careful detergent screening to identify optimal solubilization conditions

    • Addition of stabilizing lipids or ligands during purification

  • Sample Preparation Innovations:

    • Reconstitution into nanodiscs to provide a more native-like lipid environment

    • Use of antibody fragments or nanobodies to stabilize specific conformations

    • Application of GraFix (gradient fixation) to reduce conformational heterogeneity

  • Methodological Advances:

    • Integration of data from multiple structural techniques (X-ray, cryo-EM, NMR)

    • Computational modeling to bridge gaps in experimental data

    • Development of new membrane mimetics that better maintain native structure

Recent successful structural studies of the PotD-PotABC complex using cryo-EM demonstrate that these challenges can be overcome with appropriate strategies . The ability to capture different conformational states provides valuable insights into the transport mechanism that would be difficult to obtain using crystallography alone.

What purification strategies work best for isolating recombinant PotB while maintaining its native conformation?

Purifying membrane proteins like PotB requires specialized strategies to maintain the integrity of hydrophobic transmembrane domains:

Membrane Preparation:

  • Efficient cell lysis methods (French press, sonication, or enzymatic lysis)

  • Differential centrifugation to isolate membrane fractions

  • Washing steps to remove peripheral membrane proteins

Detergent Solubilization:

  • Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM), CHAPS, or digitonin

  • Optimization of detergent concentration, solubilization time, and temperature

  • Addition of lipids during solubilization to stabilize the protein

Affinity Chromatography:

  • Addition of affinity tags (His6, FLAG, Strep-tag) positioned to avoid interfering with function

  • Immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins for His-tagged proteins

  • Gentle elution conditions to maintain native structure

Size Exclusion Chromatography:

  • Separates proteins based on size and shape

  • Removes aggregates and isolates homogeneous populations

  • Provides information about the oligomeric state

Stabilization Strategies:

  • Addition of specific lipids that maintain functionality

  • Inclusion of glycerol or other osmolytes to prevent denaturation

  • Use of amphipathic polymers (amphipols) or nanodiscs for detergent-free purification

  • Addition of substrate or inhibitors to stabilize specific conformations

For purification of the complete PotD-PotABC complex, a successful approach involves purifying individual components separately and then reconstituting the complex by incubating them together in the presence of substrate (spermidine), ATP, and magnesium ions .

How can the function of recombinant PotB be assessed in vitro?

Assessing the functionality of recombinant PotB requires methods that measure its ability to participate in polyamine transport as part of the PotD-PotABC complex:

Reconstitution Approaches:

  • Proteoliposomes: Incorporation of purified PotABC complex into artificial lipid vesicles

  • Nanodiscs: Reconstitution into small lipid bilayer discs stabilized by membrane scaffold proteins

  • Planar lipid bilayers: Formation of membrane bilayers across an aperture for electrophysiological measurements

Transport Assays:

  • Radiolabeled substrate uptake: Measuring the accumulation of ³H or ¹⁴C-labeled spermidine inside reconstituted vesicles

  • Fluorescence-based assays: Using environment-sensitive fluorescent probes to monitor substrate movement

  • FRET-based approaches: Detecting conformational changes associated with transport

Binding Assays:

  • Isothermal titration calorimetry (ITC): Measuring the thermodynamics of substrate binding

  • Surface plasmon resonance (SPR): Determining binding kinetics in real-time

  • Fluorescence anisotropy: Monitoring changes in rotational diffusion upon substrate binding

ATP Hydrolysis Assays:

  • Colorimetric assays (e.g., malachite green) to measure inorganic phosphate release

  • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation

  • These assays determine if PotB correctly assembles with PotA to form a functional ATPase complex

For comprehensive functional characterization, combining multiple approaches provides the strongest evidence for functional integrity. For example, demonstrating both substrate binding and ATP-dependent transport in reconstituted systems confirms proper folding and assembly of the recombinant PotB protein.

What expression vectors and conditions optimize recombinant PotB production?

Optimizing recombinant PotB production requires careful selection of expression vectors and conditions:

Expression Vector Features:

  • Tunable promoters (T7-lac, trc, arabinose-inducible) to control expression levels

  • Appropriate affinity tags (His6, FLAG, Strep-tag) for purification

  • Signal sequences or fusion partners to enhance membrane insertion

  • Antibiotic resistance markers compatible with host strains

  • Origin of replication controlling plasmid copy number

Optimal Expression Conditions:

  • Temperature: Typically lower (18-25°C) to slow protein production and facilitate proper folding

  • Induction timing: Induction at mid-log phase (OD600 ~0.6-0.8) often yields better results

  • Inducer concentration: Titration to find optimal levels that balance yield and toxicity

  • Media composition: Enriched media or defined media supplemented with specific nutrients

  • Duration: Extended expression times (overnight or longer) at lower temperatures

Host Strain Selection:

  • C41(DE3) and C43(DE3): Specifically developed for membrane protein expression in E. coli

  • Lemo21(DE3): Allows tunable expression of membrane proteins

  • BL21(DE3)pLysS: Reduces basal expression to minimize toxicity

  • Rosetta strains: Provide rare tRNAs that might be needed for efficient translation

Innovative Approaches:

  • Vesicle-packaged expression system using the VNp peptide tag

  • Two-stage temperature protocols (growth at 37°C, induction at 18-20°C)

  • Co-expression with chaperones or folding modulators

  • Addition of specific lipids or ligands during expression

Recent innovations in expression systems, such as the vesicle-nucleating peptide (VNp) approach, have shown particular promise for membrane proteins. This system generates recombinant-protein-filled vesicles from E. coli, enabling high-yield production of otherwise challenging proteins .

What analytical techniques are most effective for characterizing the structure of recombinant PotB?

Multiple analytical techniques can be combined to thoroughly characterize the structure of recombinant PotB:

High-Resolution Structural Methods:

  • Cryo-electron microscopy (cryo-EM): Particularly effective for the complete PotD-PotABC complex

  • X-ray crystallography: If well-diffracting crystals can be obtained

  • Nuclear magnetic resonance (NMR): For specific domains or in combination with other methods

Spectroscopic Techniques:

  • Circular dichroism (CD): Assesses secondary structure content and stability

  • Fourier-transform infrared spectroscopy (FTIR): Provides information about secondary structure in membrane environments

  • Fluorescence spectroscopy: Monitors the environment of intrinsic tryptophan residues as indicators of tertiary structure

Biophysical Characterization:

  • Analytical ultracentrifugation: Determines oligomeric state and homogeneity

  • Dynamic light scattering: Assesses size distribution and aggregation state

  • Differential scanning calorimetry: Measures thermal stability and domain organization

Mapping Techniques:

  • Limited proteolysis combined with mass spectrometry: Identifies flexible regions and domain boundaries

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps solvent-accessible regions and conformational dynamics

  • Cross-linking mass spectrometry: Identifies spatial relationships between residues

In Situ Methods:

  • Fluorescence lifetime imaging microscopy (FLIM): Can be used to study protein-membrane interactions in living cells

  • Förster resonance energy transfer (FRET): Detects conformational changes and protein-protein interactions

  • Super-resolution microscopy: Visualizes distribution and organization in cellular contexts

Recent structural studies successfully employed cryo-EM to capture different conformational states of the PotD-PotABC complex, revealing distinct "inward-facing" and "outward-facing" conformations and elucidating the spermidine uptake mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.