Recombinant Escherichia coli Spermidine/putrescine transport system permease protein PotC (potC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli Spermidine/Putrescine Transport System Permease Protein PotC (potC)

Recombinant Escherichia coli Spermidine/Putrescine transport system permease protein PotC (potC) is a transmembrane component of the ATP-binding cassette (ABC) transporter PotABCD, which facilitates the uptake of polyamines like spermidine and putrescine. These polyamines are critical for bacterial growth, biofilm formation, and stress responses . Recombinant PotC is produced through genetic engineering in E. coli systems, enabling structural, functional, and biochemical studies .

Molecular Architecture

  • Gene Location: The potC gene is part of the potABCD operon in E. coli .

  • Protein Domains:

    • Six transmembrane helices arranged with pseudosymmetry .

    • A periplasmic loop (P2) shorter than its homolog PotB .

  • Molecular Weight: ~29.1 kDa (theoretical) .

Mechanism in Polyamine Transport

PotC partners with PotB to form a heterodimeric transmembrane channel, while PotA (ATPase) and PotD (periplasmic binding protein) drive spermidine uptake via ATP hydrolysis . Critical interactions include:

  • Spermidine Binding: Asp108 and Asp198 in PotC directly coordinate spermidine .

  • ATPase Coupling: Glu169 in PotC modulates ATP hydrolysis by PotA .

Expression Systems

  • Host Organism: Escherichia coli (strains O157:H7 or K-12) .

  • Tags: Often fused with N-terminal His tags for purification .

  • Yield: Produced in soluble form with proper folding, optimized for biochemical assays .

Table 2: Recombinant PotC Production Details

ParameterSpecification
Expression VectorpET-based or custom plasmids
Purification MethodAffinity chromatography (Ni-NTA)
Storage BufferTris-based buffer with 50% glycerol, pH 7.4–8.0
StabilityStable at -80°C; avoid repeated freeze-thaw cycles

Functional Validation

  • Transport Assays: Mutagenesis studies confirm PotC’s role in spermidine uptake (e.g., Asp198 mutants reduce transport efficiency by >70%) .

  • Structural Studies: Cryo-EM structures (3.0–3.5 Å resolution) reveal conformational changes during spermidine translocation .

Role in Bacterial Physiology

  • Biofilm Formation: Intracellular spermidine levels regulated by PotABCD enhance E. coli biofilm formation .

  • Stress Adaptation: PotC contributes to survival under oxidative stress and nutrient limitation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
potC; b1124; JW1110; Spermidine/putrescine transport system permease protein PotC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
potC
Target Protein Sequence
MIGRLLRGGFMTAIYAYLYIPIIILIVNSFNSSRFGINWQGFTTKWYSLLMNNDSLLQAA QHSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFM LLGIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL AMPAVAAGWVLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVL SLVMVIASQLIARDKTKGNTGDVK
Uniprot No.

Target Background

Function
Essential for the activity of the bacterial periplasmic transport system responsible for putrescine and spermidine uptake.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant PotC production?

While several expression systems exist, E. coli remains a preferred host for recombinant PotC expression due to its well-characterized genetics, rapid growth, and high protein yields. The choice of expression vector significantly impacts success rates, with thermoinducible lambda pL promoter systems showing particular promise for membrane proteins. For instance, similar membrane proteins have achieved expression levels of 5-10% of total bacterial protein using these systems . The choice between BL21(DE3), C41(DE3), and C43(DE3) strains depends on the specific experimental goals, with C41/C43 strains often preferred for membrane proteins due to their adapted physiology for toxic protein expression.

How can researchers optimize solubilization and purification of recombinant PotC?

For membrane proteins like PotC, effective solubilization requires careful detergent selection. Based on protocols for similar transmembrane proteins, extraction with either 8M urea or gentler detergents like 0.1% cetyltrimethylammonium bromide has proven effective . The purification workflow typically involves:

  • Bacterial cell disruption via sonication or mechanical lysis

  • Separation of membrane fractions through differential centrifugation

  • Solubilization with appropriate detergent

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for final purification

Success rates can be monitored through SDS-PAGE analysis, with homogeneity of the final protein preparation being a critical quality control checkpoint .

What are the advantages and limitations of using fusion tags for PotC purification?

For membrane proteins like PotC, fusion tags serve multiple purposes beyond simple purification. Experimental evidence indicates that C-terminal tags are often more effective than N-terminal tags for maintaining proper membrane insertion and orientation. Similar to approaches used with other recombinant membrane proteins, sortase A (SrtA) recognition sequences can be engineered at the C-terminus of PotC to enable site-specific labeling or conjugation . This approach facilitates not only purification but also subsequent functional studies or conjugation to reporting molecules.

The following table summarizes common fusion tags for membrane protein purification:

Tag TypeSize (kDa)AdvantageLimitationCleavage Option
His₆0.8Minimal size, compatible with denaturing conditionsMay affect protein foldingTEV protease
MBP42Enhances solubilityLarge size may interfere with functionFactor Xa
GST26Folding monitorPoor performance with membrane proteinsThrombin
SUMO11Native N-terminus after cleavageModerate sizeSUMO protease
SrtA motif<1Site-specific conjugationRequires oligoglycine acceptorTranspeptidation

What computational approaches can predict PotC structure in the absence of crystallographic data?

In the absence of direct crystallographic data for PotC, several computational approaches can provide structural insights:

  • Homology modeling based on related channel proteins

  • Normal mode-based flexible fitting of related structures into EM densities

  • Molecular dynamics simulations to predict conformational changes

These approaches have been successfully applied to other E. coli membrane transport proteins. For example, normal mode-based flexible fitting of archaeal SecYEβ structures into electron microscopy densities has provided insights into channel formation mechanisms that could be applicable to PotC structure prediction . These computational models can generate testable hypotheses about the mechanism of spermidine/putrescine transport.

How can cryo-electron microscopy be optimized for PotC structural analysis?

Cryo-EM has emerged as a powerful technique for membrane protein structural analysis without the need for crystallization. Based on successful approaches with other E. coli membrane proteins such as SecYEG , optimization strategies for PotC should include:

  • Sample preparation in amphipathic environments (detergent micelles, nanodiscs, or lipid nanodiscs)

  • Vitrification conditions that minimize ice thickness

  • Data collection parameters optimized for membrane proteins (defocus range of -1.5 to -3.5 μm)

  • Image processing workflows that account for preferred orientation issues

Recent cryo-EM reconstructions of similar E. coli membrane proteins have achieved resolutions sufficient to visualize transmembrane helices and substrate binding sites, which would be applicable to understanding PotC's role in polyamine transport .

What insights can be gained from studying PotC in complex with the complete transport system?

Advanced structural studies should examine PotC not in isolation but as part of the complete PotABCD transport system. Similar to the approach used with the SecYEG translocon , reconstituting the entire complex provides insights into:

  • Subunit interactions and stoichiometry

  • Conformational changes during transport

  • Substrate binding sites and selectivity filters

  • Energy coupling mechanisms

Studies of related transport systems suggest that PotC likely forms connections with other system components to create a selective channel for polyamine transport, with specific residues contributing to substrate recognition .

What in vitro assays can effectively measure PotC transport activity?

Functional characterization of PotC requires assays that can quantify transport activity in reconstituted systems. Based on protocols developed for similar membrane transporters, researchers should consider:

  • Liposome reconstitution assays using purified PotC (alone or with PotABD)

  • Fluorescence-based transport assays using labeled spermidine/putrescine

  • Electrophysiological measurements in planar lipid bilayers

  • Isothermal titration calorimetry for binding affinity determination

These assays should be designed to measure transport kinetics (Km and Vmax values) and substrate specificity, providing quantitative data on how mutations or environmental conditions affect transport function.

How can researchers distinguish between PotC's role in substrate recognition versus membrane translocation?

Distinguishing between recognition and translocation functions requires complementary approaches:

  • Site-directed mutagenesis targeting conserved residues

  • Chimeric constructs swapping domains with related transporters

  • Cross-linking studies to identify substrate interaction sites

  • Accessibility scanning using cysteine modification reagents

These approaches, similar to those used with SecY , can map the substrate translocation pathway through the membrane and identify residues critical for spermidine/putrescine recognition versus those involved in the translocation process itself.

What are the best approaches for studying PotC interactions with other components of the transport system?

Understanding protein-protein interactions within the PotABCD system requires multiple methods:

  • Pull-down assays using tagged PotC variants

  • Surface plasmon resonance to quantify binding kinetics

  • Förster resonance energy transfer (FRET) to measure proximity in reconstituted systems

  • In vivo cross-linking followed by mass spectrometry

These methods can reveal how PotC interacts with the ATP-binding protein (PotA) and other components to couple energy expenditure to substrate transport, similar to interaction studies performed with other bacterial transport systems .

What CRISPR-Cas9 strategies are most effective for potC gene manipulation?

For precise genetic manipulation of the potC gene, CRISPR-Cas9 systems optimized for E. coli offer several advantages:

  • Single nucleotide precision for point mutations

  • Marker-free modifications for physiological expression levels

  • Multiplex editing capability for studying interactions with other pot genes

The editing efficiency depends on several factors:

FactorOptimal ConditionEffect on Efficiency
sgRNA design20 nt with NGG PAM proximal to target site>80% with optimal design
Cas9 expressionTunable promoter systemsReduces toxicity
Repair template>500 bp homology armsIncreases HDR efficiency
Selection strategyCRISPR-inhibited negative selectionEnriches for edited cells

How should researchers interpret conflicting functional data between in vitro and in vivo PotC studies?

Reconciling conflicting data requires systematic investigation of several factors:

  • Expression level differences between systems (Western blotting quantification)

  • Post-translational modifications present in vivo but absent in vitro

  • Missing interaction partners in reconstituted systems

  • Differences in membrane composition affecting protein function

Similar discrepancies have been observed with other E. coli membrane proteins, including SecYEG, where fluorescence data initially appeared to contradict structural findings . A methodical comparison of experimental conditions can often resolve these apparent contradictions.

How can PotC be engineered as a component of synthetic biology circuits?

Adapting PotC for synthetic biology applications requires consideration of:

  • Promoter engineering for tunable expression

  • Protein fusion strategies that maintain transport function

  • Integration with sensing or response elements

  • Optimization for specific host chassis beyond E. coli

Drawing parallels from the engineering of trastuzumab fragment antibodies with SrtA-recognition motifs , PotC could be modified with similar recognition sequences to enable site-specific conjugation to synthetic biology components while maintaining its native transport function.

What approaches enable studying real-time conformational changes in PotC during transport?

Capturing the dynamic nature of PotC during transport requires sophisticated biophysical techniques:

  • Site-specific fluorophore labeling at non-conserved residues

  • Single-molecule FRET to detect distance changes during transport

  • Electron paramagnetic resonance (EPR) spectroscopy with spin labels

  • Time-resolved structural methods (TR-SAXS, TR-EM)

These approaches have revealed insights into the conformational changes of other membrane transporters, showing how they alternate between inward-facing and outward-facing states during the transport cycle.

How can molecular dynamics simulations complement experimental studies of PotC?

Modern computational approaches offer powerful complements to experimental data:

  • All-atom MD simulations to predict substrate pathways

  • Coarse-grained models for long-timescale conformational changes

  • Free energy calculations for substrate binding affinity prediction

  • Machine learning integration for pattern recognition in simulation data

Similar computational approaches applied to SecY have supported a model where two linked halves of the protein open during polypeptide translocation , providing a conceptual framework that could be applied to understanding PotC's transport mechanism.

What strategies address poor expression yields of recombinant PotC?

Low expression yields are common with membrane proteins like PotC. Based on successful approaches with other recombinant membrane proteins in E. coli, researchers should consider:

  • Testing multiple promoter systems (arabinose-inducible, T7, trc)

  • Optimizing induction conditions (temperature, time, inducer concentration)

  • Using specialized strains like C41(DE3) or Lemo21(DE3)

  • Adding fusion partners known to enhance membrane protein expression (MBP, SUMO)

  • Codon optimization for E. coli expression

Systematic optimization has achieved yields of 5-10% of total bacterial protein for other challenging membrane proteins .

How can researchers overcome protein misfolding issues with recombinant PotC?

Membrane protein misfolding presents significant challenges. Strategies to improve folding include:

  • Slowing expression rate through reduced temperature (16-25°C)

  • Addition of chemical chaperones (glycerol, DMSO at low concentrations)

  • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

  • Using milder detergents for extraction (DDM, LMNG)

Additionally, researchers should consider using aggregation prediction software to identify problematic regions that could be modified to improve folding while maintaining function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.