Recombinant Escherichia coli Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

Shipped with Ice Packs
In Stock

Description

Introduction to Succinate Dehydrogenase and the sdhD Subunit

Succinate dehydrogenase, also known as Complex II or succinate:quinone oxidoreductase, is a crucial enzyme involved in both the tricarboxylic acid (TCA) cycle and the electron transport chain (ETC) in bacteria like Escherichia coli (E. coli) . This enzyme is composed of four non-identical subunits encoded by the sdhCDAB operon. Among these, the sdhD gene encodes a small hydrophobic subunit that plays a pivotal role in anchoring the catalytic subunits to the cytoplasmic membrane .

Structure and Function of the sdhD Subunit

The sdhD subunit, along with sdhC, forms the hydrophobic membrane anchor of succinate dehydrogenase. These subunits are essential for the assembly and function of the enzyme, facilitating the ligation of a heme group between them . The heme group is crucial for the electron transfer process during the oxidation of succinate to fumarate . The sdhD subunit is believed to encode the small subunit (cybS) of cytochrome b556, which is part of the succinate dehydrogenase complex in E. coli .

Assembly and Function of Succinate Dehydrogenase

Studies have shown that both sdhC and sdhD are necessary for the proper assembly of succinate dehydrogenase in the membrane. Without these subunits, the catalytic portion of the enzyme remains in the cytoplasm, lacking succinate-ubiquinone oxidoreductase activity . The presence of both sdhC and sdhD ensures the correct localization of the enzyme in the membrane, enabling its full enzymatic activity .

Impact on Metabolic Pathways

Disruption of the succinate dehydrogenase complex, including the sdhA and sdhC genes, has been shown to affect bacterial virulence in pathogens like Enterohemorrhagic E. coli (EHEC). This disruption leads to succinate accumulation and fumarate depletion, impacting the TCA cycle and electron transport chain . While sdhD is not directly implicated in these studies, its role in maintaining enzyme function is crucial for normal metabolic processes.

Data Table: Succinate Production in Engineered E. coli Strains

StrainsSuccinate Titer (mM)
MG1655Not detected
WCY-11.68 ± 0.13
WCY-22.04 ± 0.23
WCY-34.62 ± 0.34
WCY-45.02 ± 0.28
WCY-55.95 ± 0.34
WCY-69.87 ± 1.43
WCY-711.23 ± 1.23

This table illustrates the impact of genetic modifications on succinate production in E. coli, although it does not directly involve the sdhD subunit .

References Production of succinate by recombinant Escherichia coli using acetate as the sole carbon source. Two Hydrophobic Subunits Are Essential for the Heme B Ligation and Functional Assembly of Complex II in Escherichia coli. Anaerobic Expression of Escherichia coli Succinate Dehydrogenase. The assembly of succinate dehydrogenase: a key enzyme in both oxidative phosphorylation and the tricarboxylic acid cycle. A multi-omic analysis reveals the role of fumarate in regulating the virulence of Enterohemorrhagic Escherichia coli.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will fulfill it as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, it is recommended to briefly centrifuge the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to incorporate your preferred tag type during production. If you have specific tag requirements, please inform us, and we will prioritize fulfilling your request.
Synonyms
sdhD; b0722; JW0712; Succinate dehydrogenase hydrophobic membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
Target Protein Sequence
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
Uniprot No.

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH).
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural role of SdhD in the succinate dehydrogenase complex?

SdhD serves as one of the two hydrophobic membrane anchor subunits of succinate dehydrogenase (Complex II). Together with SdhC (Sdh3 in yeast), it forms a heterodimer that anchors the catalytic subunits to the inner mitochondrial membrane. The membrane anchor domain formed by SdhC-SdhD houses an intercalated heme b moiety and provides the binding site for ubiquinone, connecting the hydrophobic mobile electron carrier to the hydrophilic domain of SDH . This structural arrangement is critical for maintaining the functional integrity of the enzyme complex within the electron transport chain.

How does the SdhD subunit contribute to electron transport function?

The SdhD subunit, as part of the membrane anchor domain, plays a crucial role in the terminal electron transfer steps within succinate dehydrogenase. While the catalytic Sdh1 (SDHA) subunit oxidizes succinate to fumarate and reduces FAD to FADH₂, and the Sdh2 (SDHB) subunit contains the iron-sulfur clusters that transfer electrons from FAD, the SdhD-SdhC membrane anchor provides the ubiquinone binding site . This binding site completes the electron transfer pathway by accepting electrons from the iron-sulfur clusters and transferring them to ubiquinone, reducing it to ubiquinol. The proper positioning of SdhD is therefore essential for the final step in the electron transfer chain within the complex.

What are the key differences between E. coli SdhD and mammalian SDHD?

While both E. coli SdhD and mammalian SDHD serve as hydrophobic membrane anchors in their respective succinate dehydrogenase complexes, they differ in several aspects:

FeatureE. coli SdhDMammalian SDHD
SizeTypically smallerLarger with additional structural elements
Membrane topologySimpler structureMore complex transmembrane domains
Post-translational modificationsMinimalMore extensive
Interaction with assembly factorsFewer specific assembly factorsRequires specific assembly factors
Disease associationNot applicableMutations linked to paragangliomas and pheochromocytomas

These differences reflect evolutionary adaptations while maintaining the core function of membrane anchoring and ubiquinone binding.

What experimental approaches can be used to study SdhD-ubiquinone interactions?

Studying SdhD-ubiquinone interactions requires specialized experimental approaches:

  • Site-directed mutagenesis: Modifying specific amino acid residues in the putative ubiquinone binding pocket of SdhD to assess their impact on enzyme kinetics and electron transfer efficiency .

  • Crosslinking studies: Using photoactivatable ubiquinone analogs that can be covalently linked to nearby amino acid residues upon illumination, followed by mass spectrometry analysis to identify interaction sites.

  • Structural biology approaches: X-ray crystallography or cryo-electron microscopy of the SDH complex with bound ubiquinone or competitive inhibitors to visualize binding interactions at atomic resolution.

  • Computational modeling: Molecular dynamics simulations to predict ubiquinone binding modes and energetics based on existing structural data from homologous proteins.

  • Electron paramagnetic resonance (EPR) spectroscopy: To detect semiquinone intermediates formed during electron transfer, providing insights into the mechanism of ubiquinone reduction.

These methods can reveal both the structural basis of ubiquinone binding and the functional consequences of specific interactions with the SdhD subunit.

How can researchers effectively purify recombinant E. coli SdhD while maintaining its native structure?

Purification of recombinant E. coli SdhD presents significant challenges due to its hydrophobic nature and requirement for membrane association. An effective purification protocol typically includes:

  • Expression system optimization: Using specialized E. coli strains (C41/C43) designed for membrane protein expression, often with reduced expression temperatures (16-25°C) to improve proper folding.

  • Solubilization strategy: Careful selection of detergents that effectively solubilize SdhD while preserving protein structure. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are often preferred over harsher alternatives.

  • Affinity purification: Incorporation of affinity tags (His6, Strep, or FLAG) positioned to minimize interference with protein folding and function, followed by immobilized metal affinity chromatography.

  • Co-expression approach: Co-expressing SdhD with SdhC to stabilize the membrane anchor heterodimer, which often improves yield and structural integrity.

  • Reconstitution into nanodiscs or liposomes: Transfer of purified SdhD from detergent micelles into lipid bilayer environments that better mimic the native membrane context.

This methodical approach helps maintain the structural integrity of SdhD throughout the purification process, producing protein samples suitable for subsequent structural and functional studies.

What is the role of SdhD in the assembly pathway of the complete succinate dehydrogenase complex?

The assembly of succinate dehydrogenase follows a coordinated pathway in which SdhD plays a crucial role:

  • Early membrane anchor formation: SdhD and SdhC likely dimerize early in the assembly process to form the membrane anchor module .

  • Heme incorporation: The SdhC-SdhD heterodimer provides the structural environment for incorporation of the heme b cofactor, which occurs before association with the catalytic subunits.

  • Interface for catalytic domain docking: The SdhD-SdhC module creates the binding interface for the subsequent attachment of the Sdh2 (SDHB) iron-sulfur protein .

  • Sequential assembly: Recent studies suggest that Sdh1 and Sdh2 likely dimerize prior to membrane association with the SdhC-SdhD anchor, rather than sequentially docking onto the membrane anchor .

  • Assembly factor interactions: The assembly process is facilitated by subunit-specific assembly factors that aid in the maturation of individual subunits and support the assembly of the intact complex.

This ordered assembly pathway ensures the proper incorporation of all cofactors and the formation of a functionally active enzyme complex capable of participating in both the tricarboxylic acid cycle and the electron transport chain.

How do mutations in SdhD affect the function and assembly of succinate dehydrogenase?

Mutations in SdhD can have various effects on SDH function and assembly, depending on their location and nature:

  • Ubiquinone binding disruption: Mutations in residues lining the ubiquinone binding pocket can alter affinity for ubiquinone or change the redox properties of the binding site, disrupting electron transfer to the ubiquinone pool.

  • Heme coordination defects: Alterations in amino acids involved in heme coordination can lead to improper incorporation of the heme b cofactor or changes in its redox potential.

  • Subunit interaction impairment: Mutations at interfaces between SdhD and other subunits (particularly SdhC and SdhB) can weaken these interactions, leading to unstable or incompletely assembled complexes.

  • Membrane integration problems: Changes in transmembrane domains can affect proper integration into the lipid bilayer, potentially causing misfolding or aggregation.

  • Assembly pathway disruption: Some mutations may interfere with the recognition of SdhD by specific assembly factors, preventing proper maturation and incorporation into the complex.

In mammalian systems, SDHD mutations are associated with paragangliomas and pheochromocytomas, suggesting critical roles in cellular metabolism and tumor suppression . Similar studies in E. coli can provide valuable models for understanding these disease mechanisms.

What techniques are most effective for studying the membrane topology of recombinant E. coli SdhD?

Several complementary techniques can effectively determine the membrane topology of recombinant E. coli SdhD:

  • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility studies using membrane-permeable and impermeable sulfhydryl reagents.

  • Protease protection assays: Limited proteolysis of inside-out and right-side-out membrane vesicles containing SdhD, followed by mass spectrometry analysis of protected fragments.

  • Fluorescence resonance energy transfer (FRET): Strategic placement of fluorescent probes at predicted loops to measure distances between protein regions and membrane surfaces.

  • Glycosylation mapping: Introduction of glycosylation sites at various positions to identify regions exposed to glycosylation machinery.

  • Cryo-electron microscopy: Direct visualization of the protein within the membrane environment at near-atomic resolution, particularly effective when examining the complete SDH complex.

These approaches provide complementary data that, when combined, can generate a comprehensive topological map of SdhD within the membrane, revealing the orientation of transmembrane segments and the location of functional domains.

How can researchers assess the impact of modified ubiquinone binding sites in recombinant SdhD?

Researchers can employ multiple approaches to assess how modifications to the ubiquinone binding site affect SdhD function:

  • Enzyme kinetics: Measuring changes in Km and Vmax for ubiquinone using purified SDH complexes containing modified SdhD.

  • Oxygen consumption assays: Monitoring the rate of oxygen consumption in membrane preparations or reconstituted systems as an indicator of electron transport efficiency.

  • Redox potential measurements: Determining changes in the redox potential of the ubiquinone binding site using techniques such as potentiometric titration.

  • Binding affinity studies: Employing isothermal titration calorimetry or surface plasmon resonance to quantify changes in ubiquinone binding affinity and thermodynamics.

  • Inhibitor sensitivity profiling: Testing sensitivity to competitive inhibitors such as 3-nitropropionic acid that bind at or near the ubiquinone site .

  • Reactive oxygen species (ROS) measurements: Quantifying ROS production, which often increases when electron transfer through the ubiquinone site is impaired.

These methods provide quantitative assessments of how modifications to the ubiquinone binding site affect both structural and functional aspects of SdhD within the succinate dehydrogenase complex.

What approaches can be used to study the interaction between SdhD and SdhC in the membrane anchor assembly?

Understanding the interaction between SdhD and SdhC requires specialized techniques appropriate for membrane protein complexes:

  • Co-immunoprecipitation and pull-down assays: Using tagged versions of SdhD or SdhC to isolate the intact heterodimer and identify interaction domains.

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect protein-protein interactions in a cellular context.

  • Crosslinking mass spectrometry: Chemical or photo-crosslinking followed by mass spectrometry to identify residues in close proximity at the SdhC-SdhD interface.

  • Förster resonance energy transfer (FRET): Labeling SdhC and SdhD with appropriate fluorophores to measure interaction distances and dynamics.

  • Hydrogen-deuterium exchange mass spectrometry: Identifying regions of altered solvent accessibility upon complex formation, revealing interaction interfaces.

  • Molecular dynamics simulations: Computational modeling of the SdhC-SdhD interaction based on structural data to predict key stabilizing interactions and conformational changes.

These approaches can reveal both static structural features of the heterodimer and dynamic aspects of its assembly process, providing insights into this crucial step in SDH biogenesis.

What are the primary challenges in expressing functional recombinant E. coli SdhD, and how can they be overcome?

Researchers face several significant challenges when expressing recombinant E. coli SdhD:

ChallengeSolution Approach
Protein toxicity during overexpressionUse tightly regulated expression systems; lower induction levels; employ specialized C41/C43 E. coli strains designed for toxic membrane proteins
Improper membrane insertionOptimize signal sequences; use native E. coli expression systems; consider in vitro translation systems with artificial membranes
Protein aggregationLower expression temperature (16-20°C); add membrane-mimetic compounds to growth media; use solubility-enhancing fusion partners
Co-factor incorporationCo-express with heme biosynthesis enzymes; supplement growth media with δ-aminolevulinic acid as a heme precursor
Incomplete complex formationCo-express with other SDH subunits; include assembly factors in expression system
Functional assessment difficultiesDevelop specialized activity assays for partial complexes; use complementation of SdhD-deficient strains as functional readout

Addressing these challenges requires a multi-faceted approach, often combining genetic modifications of expression systems with optimized growth and purification conditions tailored specifically to membrane proteins like SdhD.

How can researchers effectively study the role of SdhD in electron transfer through the succinate dehydrogenase complex?

Studying the role of SdhD in electron transfer requires specialized techniques that can capture the dynamics of electron movement:

  • Electron paramagnetic resonance (EPR) spectroscopy: To monitor the redox state of cofactors (particularly the heme b associated with the SdhC-SdhD module) during electron transfer.

  • Fast kinetics measurements: Stopped-flow spectroscopy or freeze-quench techniques coupled with spectroscopic methods to capture transient intermediates during electron transfer.

  • Site-directed mutagenesis of conserved residues: Systematic modification of amino acids predicted to be involved in electron transfer pathways, followed by functional assessment.

  • Inhibitor studies: Using specific inhibitors that block electron transfer at different points in the pathway to delineate the role of SdhD.

  • Computational modeling of electron tunneling pathways: Theoretical calculations of electron transfer rates based on distances between redox centers and protein environment.

  • Reconstitution experiments with modified quinones: Using quinone analogs with altered redox properties to probe the terminal electron transfer step involving SdhD.

These approaches can reveal both the structural elements of SdhD that facilitate electron transfer and the kinetic parameters that govern the efficiency of this crucial process in energy metabolism.

What considerations are important when designing experiments to study the impact of SdhD modifications on gut microbiota and metabolism?

When studying how SdhD modifications in E. coli might impact gut microbiota and metabolism, researchers should consider:

  • Ecological context: E. coli with modified SdhD may exhibit altered fitness in the competitive gut environment, particularly under changing oxygen conditions where succinate dehydrogenase function becomes critical .

  • Metabolic shifts: Changes in SdhD function can alter the balance between aerobic and anaerobic metabolism, potentially affecting production of short-chain fatty acids like acetate and butyrate that influence host physiology .

  • Cross-feeding interactions: Modified succinate metabolism in E. coli may disrupt metabolic cross-feeding relationships with other microbiota members, particularly beneficial bacteria like Bifidobacterium and Ruminococcus species .

  • Experimental models: Consider both in vitro models (continuous culture systems, biofilm models) and in vivo models (gnotobiotic animals, humanized microbiome models) to capture complex interactions.

  • Multi-omics approaches: Combine metagenomics, metabolomics, and transcriptomics to capture both population shifts and functional changes in the microbiota following introduction of E. coli with modified SdhD .

  • Host-microbe interactions: Assess how changes in E. coli metabolism resulting from SdhD modifications might affect host inflammatory responses, intestinal barrier function, and systemic metabolism.

Research in this area is particularly relevant given emerging connections between altered microbial metabolism and host conditions such as ADHD, where studies have shown correlations between specific bacterial populations and clinical symptoms .

What are the most effective structural biology approaches for studying recombinant E. coli SdhD?

Several cutting-edge structural biology techniques are particularly valuable for studying SdhD:

  • Cryo-electron microscopy (cryo-EM): Especially powerful for membrane protein complexes like SDH, allowing visualization of the protein in a near-native lipid environment without crystallization. Recent advances in detection and processing have enabled near-atomic resolution of membrane protein structures.

  • X-ray crystallography of the complete SDH complex: While challenging, this approach has successfully revealed the atomic structure of bacterial and mammalian SDH complexes . Co-crystallization with inhibitors or substrate analogs can provide additional functional insights.

  • Solid-state NMR spectroscopy: Particularly useful for studying specific domains or conformational changes in SdhD within a membrane environment.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility, complementing static structural approaches.

  • Single-particle electron microscopy: Useful for studying conformational heterogeneity and structural changes associated with different functional states of the SDH complex.

  • Integrative structural biology: Combining multiple techniques (crystallography, NMR, SAXS, crosslinking, computational modeling) to generate comprehensive structural models when individual methods prove insufficient.

How can systems biology approaches enhance our understanding of SdhD function in metabolic networks?

Systems biology offers powerful frameworks for understanding SdhD within broader metabolic contexts:

  • Flux balance analysis (FBA): Mathematical modeling of metabolic fluxes can predict how alterations in SDH activity due to SdhD modifications might redirect carbon flow through central metabolism.

  • Metabolic control analysis: Quantifying how changes in SDH activity (controlled by SdhD modifications) influence flux through connected metabolic pathways.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to build comprehensive models of how SdhD alterations propagate through cellular systems.

  • Mathematical modeling of disease dynamics: Similar to approaches used for SDHD-related conditions in humans , mathematical models can predict how specific SdhD modifications might alter cellular phenotypes.

  • Protein-protein interaction networks: Identifying how SdhD interacts not only with other SDH subunits but potentially with additional proteins involved in respiration, membrane organization, or protein quality control.

  • Evolutionary systems biology: Comparative analysis of SdhD across bacterial species can reveal conserved functional motifs and species-specific adaptations.

These systems-level approaches place SdhD function in a broader context, highlighting its role in coordinating electron transport with central carbon metabolism and cellular energy homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.