Recombinant Escherichia coli Sulfate transport system permease protein CysW (cysW)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Gene and Protein Characteristics

  • Gene: cysW (ECK2418, JW2416, UniProt: P0AEB0) .

  • Protein: 291 amino acids, inner membrane-localized permease subunit .

  • Recombinant Form: Full-length protein fused to an N-terminal His tag, expressed in E. coli with ≥85% purity .

PropertyDetails
Gene Location2,540,804–2,541,679 bp (E. coli K-12 MG1655 genome)
Structural DomainsTransmembrane domain critical for permease activity
Molecular FunctionABC transporter permease for sulfate, thiosulfate, and selenate

Biological Role in Sulfate Transport

CysW functions within the CysTWA complex (CysT, CysW, CysA), an ABC transporter that imports sulfate and thiosulfate into E. coli . Key features include:

  • Mechanism:

    • Partners with periplasmic binding proteins (Sbp for sulfate, CysP for thiosulfate) .

    • CysA hydrolyzes ATP to energize transport, while CysT and CysW form the transmembrane channel .

  • Essentiality:

    • Strains lacking cysW cannot grow on sulfate as a sole sulfur source due to transport failure .

    • Mutations in cysT, cysW, or cysA abolish sulfate uptake, confirming their interdependence .

Domain Architecture

  • The transmembrane domain (aa 1–436 in homologs) is sufficient for transport activity, while the cytoplasmic STAS domain (aa 437–560) is dispensable .

  • Conserved cysteine residues (e.g., C22, C91, C293 in S. thermophila YeeE homolog) are critical for substrate interaction, likely forming sulfur-binding sites .

Regulatory Interactions

  • CysR: A regulatory protein encoded adjacent to cysTWA modulates operon expression under sulfur-limiting conditions .

  • Density Dependence: Sulfate uptake via CysTWA peaks in late log phase, suggesting nutrient-sensing regulation .

Research Applications

Recombinant CysW is widely used to study:

  1. ABC Transporter Dynamics: Structural analyses of substrate binding and translocation .

  2. Sulfur Metabolism: Investigating auxotrophic mutants or engineered strains for industrial cysteine production .

  3. Antimicrobial Targets: Disrupting sulfate transport pathways in pathogenic bacteria .

ApplicationStudy Example
Heterologous ExpressionOverexpression in E. coli enhances sulfate uptake, dependent on functional CysA .
Structural BiologyCrystal structures of homologs (e.g., YeeE) reveal hourglass-like transport channels .

Comparative Analysis with Homologs

CysW homologs across species share conserved roles:

  • Synechococcus elongatus: Required for sulfate transport in cyanobacteria .

  • Mycobacterium tuberculosis: Rv1739c (SulP family) interacts with CysA for sulfate uptake, highlighting evolutionary conservation .

Industrial and Biotechnological Relevance

  • Cysteine Production: Thiosulfate transport via CysTWA is energetically favorable over sulfate, guiding metabolic engineering strategies .

  • Protein Engineering: Recombinant CysW variants are optimized for stability and activity in cell-free systems .

Key Research Findings

  1. Genetic Knockouts: ΔcysW mutants exhibit complete sulfate transport deficiency, confirming its indispensability .

  2. Synergy with CysA: Overexpression of SulP-family transporters (e.g., Rv1739c) in E. coli requires functional CysA, underscoring mechanistic coupling .

  3. Substrate Specificity: CysTWA transports selenate in addition to sulfate/thiosulfate, broadening its metabolic role .

Challenges and Future Directions

  • Structural Gaps: No high-resolution structure of CysW exists; homology modeling relies on YeeE-like proteins .

  • Biotechnological Optimization: Enhancing recombinant CysW yield and purity for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for your order.
Synonyms
cysW; b2423; JW2416; Sulfate transport system permease protein CysW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
cysW
Target Protein Sequence
MAEVTQLKRYDARPINWGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADP DMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV YLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAA ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE LLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEEHHEH
Uniprot No.

Target Background

Function
CysW is a component of the ABC transporter complex CysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.