Recombinant Escherichia coli Superinfection exclusion protein B (sieB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
sieB; b1353; JW5209; Superinfection exclusion protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
sieB
Target Protein Sequence
MLDVFTPLLKLFANEPLERLMYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFS FVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKK LERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSRRFNR
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW5209

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Superinfection Exclusion Protein B (SieB) and how does it function in bacteriophage defense mechanisms?

SieB is a prophage-encoded protein that provides superinfection exclusion against bacteriophages. Unlike other exclusion systems, SieB specifically causes cellular macromolecular synthesis to cease midway through the lytic cycle during superinfection by P22-like phages but not by P22 itself . This mechanism represents one of at least four different ways that Salmonella enterica phage P22 prophages interfere with superinfecting phages .

To experimentally characterize SieB function, researchers typically use comparative infection assays between wild-type and SieB-deficient strains. The methodological approach involves:

  • Creating isogenic strains with and without functional SieB through recombineering

  • Challenging both strains with superinfecting phages at defined multiplicities of infection

  • Measuring phage production, cellular macromolecular synthesis, and cell survival

  • Performing time-course analysis to determine the precise timing of the SieB-mediated block

What are the molecular differences between SieA and SieB mechanisms of superinfection exclusion?

The SieA and SieB proteins represent distinct mechanisms of superinfection exclusion:

FeatureSieASieB
Timing of actionEarly stage of infectionMidway through lytic cycle
MechanismBlocks transport of phage DNA across inner membrane during injectionCauses cessation of cellular macromolecular synthesis
Phage specificityBlocks P22-like phages including P22 itselfAffects P22-like phages but not P22 itself
Cellular locationInner membrane proteinNot fully characterized
Genetic requirementsSingle gene sufficient for exclusionMay involve additional factors

To investigate these differences methodologically, researchers should:

  • Create strains expressing only SieA or SieB

  • Challenge with different phages to determine specificity spectrum

  • Perform time-of-addition experiments to pinpoint when each protein blocks infection

  • Use fluorescently labeled phage DNA to track injection and localization patterns

How can recombinant SieB be expressed and purified for functional studies?

For expression and purification of recombinant SieB:

  • Clone the sieB gene into an expression vector with an appropriate tag (His-tag recommended)

  • Transform into an E. coli expression strain (BL21 or derivatives)

  • Induce expression under controlled conditions (temperature, IPTG concentration)

  • Optimize solubility through:

    • Testing different buffer conditions

    • Using fusion partners (MBP, SUMO, etc.)

    • Varying induction temperature (typically lower temperatures improve solubility)

  • Purify using affinity chromatography followed by size exclusion chromatography

For functional verification after purification:

  • Perform in vitro binding assays with phage components

  • Test the ability to inhibit phage DNA replication in cell-free systems

  • Conduct structural analysis through circular dichroism or limited proteolysis

How can recombineering techniques be optimized for sieB gene insertion into E. coli?

Recombineering offers a powerful approach for precise sieB gene integration into the E. coli chromosome. Based on the recombination system developed for E. coli chromosome engineering , the following methodological workflow is recommended:

  • Design PCR primers with:

    • 50 bp homology arms targeting the desired integration site

    • 20-25 bp for amplification of the sieB gene

    • Optional: include regulatory elements for controlled expression

  • Prepare the bacterial strain:

    • Use a strain containing a λ prophage harboring recombination genes (exo, bet, gam)

    • The prophage should be under control of temperature-sensitive λ cI-repressor

    • Grow cells at 32°C to maintain repression of recombination functions

  • Induce recombination functions:

    • Shift culture to 42°C for 15 minutes with shaking (200 rpm)

    • Immediately cool in ice water slurry for 10 minutes

    • Prepare electrocompetent cells by washing 3 times with ice-cold water

  • Transform linear DNA:

    • Electroporate 1-100 ng of purified linear sieB cassette (optimal: ~10 ng)

    • Use standard electroporation conditions: 1.8 kV, 25 μF, 200 ohms

    • Immediately add 1 ml LB medium

  • Allow segregation and select recombinants:

    • Incubate at 32°C for 1-2 hours

    • Plate on selective media if using a linked selection marker

    • For marker-free integrations, utilize counterselection strategies with sacB

  • Verify integration by:

    • PCR analysis with primers flanking the integration site

    • Sequencing to confirm precise integration

    • Functional testing for SieB expression

This approach has demonstrated high efficiency, with thousands of recombinants per electroporation for similar gene replacements .

What experimental approaches can detect and quantify SieB-mediated resistance to phage infection?

To robustly characterize SieB-mediated resistance:

  • Phage plaque assays:

    • Prepare bacterial lawns of SieB+ and SieB- strains

    • Spot serial dilutions of phage

    • Calculate efficiency of plating (EOP) using the formula:
      EOP = (PFU on test strain) / (PFU on control strain)

    • A reduction of 7+ orders of magnitude indicates strong exclusion, similar to that observed with SieA

  • Liquid culture infection kinetics:

    • Infect cultures at various MOIs (multiplicity of infection)

    • Monitor optical density over time

    • Compare growth curves between protected and unprotected strains

    • Quantify phage production at different timepoints

  • Single-cell microscopy:

    • Utilize fluorescent reporters to visualize:

      • Cell viability

      • Phage DNA replication

      • Macromolecular synthesis

    • Track individual cell fates after infection

    • Determine whether protection is all-or-none or graded

  • Molecular markers of infection:

    • Monitor host DNA degradation

    • Track phage-specific protein synthesis

    • Measure transcription of phage genes at different stages

How do SieB interactions with host cell components affect its exclusion mechanism?

Understanding SieB interactions requires a multi-faceted approach:

  • Protein-protein interaction studies:

    • Conduct yeast two-hybrid or bacterial two-hybrid screens

    • Perform co-immunoprecipitation with tagged SieB

    • Use proximity labeling techniques (BioID, APEX) to identify interaction partners

    • Validate key interactions with purified components

  • Genetic interaction mapping:

    • Create an E. coli strain library with single-gene knockouts

    • Express SieB in each strain

    • Test for altered exclusion phenotypes

    • Identify genetic dependencies and synthetic interactions

  • Subcellular localization analysis:

    • Generate fluorescent protein fusions

    • Perform immunofluorescence microscopy

    • Use cell fractionation followed by Western blotting

    • Determine if localization changes upon phage infection

  • Structural studies:

    • Determine SieB structure through X-ray crystallography or cryo-EM

    • Identify functional domains through targeted mutagenesis

    • Map interaction interfaces with host components

How can transcriptomic and proteomic approaches be used to understand SieB mechanisms and effects?

Comprehensive -omics approaches provide valuable insights:

  • RNA-Seq methodology:

    • Compare transcriptomes of:

      • SieB+ vs. SieB- cells

      • Before and after phage challenge

      • At various timepoints during infection

    • Analyze differential expression patterns

    • Identify SieB-responsive genes and pathways

  • Proteomic workflow:

    • Use stable isotope labeling (SILAC) for quantitative comparison

    • Perform shotgun proteomics on whole-cell lysates

    • Conduct targeted analysis of membrane fractions

    • Identify post-translational modifications of SieB and interacting proteins

  • Integrative analysis:

    • Correlate transcriptomic and proteomic changes

    • Build network models of SieB-mediated exclusion

    • Validate key nodes through genetic approaches

  • Time-resolved studies:

    • Capture dynamic changes during phage infection

    • Compare with other exclusion systems (e.g., SieA)

    • Identify unique vs. shared response pathways

What are the critical factors for maintaining stable SieB expression in recombinant systems?

Stable SieB expression requires careful optimization:

  • Copy number considerations:

    • Single-copy chromosomal integration often provides optimal stability

    • Even a single-copy chromosomal insertion of sieA has been shown to provide robust exclusion

    • High-copy plasmids may lead to toxicity or selection for inactivating mutations

  • Expression control strategies:

    • Use inducible promoters for controlled expression

    • Test different promoter strengths (weak to strong)

    • Consider the native P22 regulatory elements

    • Monitor growth effects under different expression conditions

  • Codon optimization:

    • Analyze codon usage patterns

    • Consider synonymous codon substitutions for expression in E. coli

    • Avoid rare codons that might limit translation

  • Strain background effects:

    • Test multiple E. coli strains (K-12, B strains)

    • Consider recA status (recombination-proficient vs. deficient)

    • Evaluate effects of host restriction-modification systems

How can potential conflicts between SieB and other phage resistance systems be analyzed and resolved?

To analyze system interactions:

  • Combinatorial strain construction:

    • Generate strains with combinations of:

      • SieB and SieA

      • SieB and CRISPR-Cas

      • SieB and restriction-modification systems

      • SieB and abortive infection systems

    • Systematically test phage resistance spectra

  • Competitive fitness assays:

    • Create mixed cultures with different protection systems

    • Challenge with various phages

    • Track population dynamics

    • Identify interference or synergy between systems

  • Molecular interference assays:

    • Test whether SieB affects CRISPR spacer acquisition

    • Determine if SieB interacts with components of other defense systems

    • Measure molecular activities in combined systems

  • Evolutionary adaptation studies:

    • Subject bacteria with multiple defense systems to phage challenge

    • Track emergence of phage counter-adaptations

    • Analyze genetic changes in both phage and bacterial populations

A sample experimental dataset from competitive fitness assays might look like:

Defense System CombinationPhage Resistance (EOP)*Growth Rate (Relative to WT)Metabolic Burden**Evolutionary Stability***
SieB only10^-50.97++++
SieA only10^-70.95++++
SieB + SieA10^-80.92++++
SieB + CRISPR-Cas10^-90.85++++
SieB + R-M system10^-70.88++++

*EOP = Efficiency of Plating (PFU on test strain / PFU on control strain)
**Metabolic burden: + (low), ++ (medium), +++ (high)
***Evolutionary stability after 100 generations: +++ (highly stable), ++ (moderately stable), + (somewhat unstable)

How might SieB be engineered for enhanced phage resistance in biotechnology applications?

Engineering approaches for SieB enhancement:

  • Structure-guided protein engineering:

    • Identify critical functional domains

    • Design mutations to improve:

      • Stability

      • Binding affinity

      • Spectrum of protection

    • Use directed evolution to select improved variants

  • Regulatory optimization:

    • Develop sensing systems that activate SieB expression upon phage detection

    • Create feedback loops for appropriate expression levels

    • Engineer orthogonal regulatory systems to minimize host burden

  • Combinatorial approaches:

    • Design synthetic operons combining SieB with complementary defense mechanisms

    • Test additive or synergistic effects

    • Optimize spacing and expression levels of combined systems

  • Heterologous expression:

    • Adapt SieB for function in industrially relevant strains

    • Test functionality in Gram-positive hosts

    • Identify minimum requirements for SieB function across species

What are the molecular determinants of specificity in SieB-mediated exclusion?

Understanding specificity determinants requires:

  • Domain mapping experiments:

    • Create chimeric proteins between SieB variants

    • Test functionality against different phages

    • Map regions responsible for phage specificity

  • Mutation analysis:

    • Generate point mutations in conserved regions

    • Test for altered specificity patterns

    • Identify residues critical for recognition

  • Phage adaptation studies:

    • Select for phages that overcome SieB exclusion

    • Sequence escapees to identify mutations

    • Map mutations to phage functional domains

  • Structural studies:

    • Determine structures of SieB-phage component complexes

    • Model interaction interfaces

    • Predict and test specificity-determining residues

How does understanding SieB contribute to broader phage-host interaction models?

SieB research contributes to understanding phage-host dynamics in several ways:

  • Evolutionary implications:

    • SieB represents one of multiple superinfection exclusion strategies evolved by P22-like phages

    • Study of SieB illuminates selective pressures driving the emergence of different defense strategies

    • SieB analysis provides insights into how phages have evolved counter-strategies

  • Systems biology perspective:

    • SieB functions within networks of phage resistance mechanisms

    • Understanding interactions between defense systems helps model bacterial survival strategies

    • SieB studies contribute to predictive models of phage infection outcomes

  • Biotechnological applications:

    • SieB mechanisms inform design of phage-resistant strains for industrial applications

    • Knowledge of SieB function contributes to phage therapy approaches

    • SieB-derived tools may enhance synthetic biology applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.