Recombinant Escherichia coli Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
dsbD; UTI89_C4733; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Escherichia coli (strain UTI89 / UPEC)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNEASQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFIMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGET HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function

Function: Facilitates the formation of correct disulfide bonds in some periplasmic proteins and the assembly of periplasmic c-type cytochromes. It acts by transferring electrons from cytoplasmic thioredoxin to the periplasm via a cascade of disulfide bond formation and reduction steps.

Database Links
Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of DsbD in the E. coli periplasmic space?

DsbD functions as a central component in the periplasmic disulfide bond formation machinery of E. coli. Its primary role is to provide reducing equivalents to DsbC, which acts as a disulfide isomerase that interacts with incorrectly folded proteins to correct non-native disulfide bonds . DsbD creates a functional link between the reducing environment of the cytoplasm and the oxidizing environment of the periplasm. In this process, DsbD transfers its disulfide bond to other proteins and becomes reduced, after which it is reoxidized by DsbD to continue the cycle . Together with DsbC and DsbG, DsbD forms part of a periplasmic reducing system that controls the level of cysteine sulfenylation and provides reducing power to rescue oxidatively damaged secreted proteins . This mechanism is essential for proper protein folding in the bacterial periplasm.

How is dsbD expression regulated in E. coli?

The expression of dsbD in E. coli is regulated by the MisR/MisS two-component system. Quantitative RT-PCR studies have shown significant decreases (8-13 fold) in dsbD transcription in misR, misS, and misRS mutants . The transcriptional defect can be rescued through complementation with an ectopically located second copy of misR or misS, confirming the regulatory role of these components .

Primer extension analysis has identified a single major transcriptional start site corresponding to the -29 cytosine nucleotide, indicating that dsbD is controlled by a single promoter . The promoter region contains appropriate -10 (TATAAT) and -35 (ATCCCA) sequences separated by 17 base pairs . Experimental evidence using dsbD::lacZ transcriptional fusions demonstrated that nucleotide sequences between -67 and +123 bp relative to the transcriptional start site are sufficient for normal expression levels, while dsbD expression remains relatively constant during exponential growth and decreases slightly in stationary phase .

How do DsbD and DsbC work together in protein folding?

DsbD and DsbC function as partners in a quality control system for protein folding in the bacterial periplasm. While DsbC acts as a disulfide isomerase that corrects non-native disulfide bonds in misfolded proteins, DsbD provides the necessary reducing power to maintain DsbC in its active reduced state . The process works as follows:

  • DsbC interacts with misfolded proteins containing incorrect disulfide bridges

  • DsbC shuffles these disulfide bonds to their correct configuration, becoming oxidized in the process

  • DsbD transfers electrons to oxidized DsbC, reducing it and allowing it to participate in another round of disulfide isomerization

  • DsbD itself becomes oxidized and must be reoxidized to continue its function

This coordinated action creates a robust system for correcting protein misfolding events in the periplasm, particularly important for proteins with multiple disulfide bonds that may form incorrect disulfide pairings during initial folding.

What are the optimal conditions for expressing recombinant DsbD in E. coli?

When expressing recombinant DsbD or similar disulfide-rich proteins, targeting the periplasm rather than the cytoplasm is critical due to the reducing environment of the E. coli cytoplasm . Based on optimized protocols for disulfide-rich proteins, several parameters should be considered:

  • Expression System Selection:

    • Use periplasmic expression vectors containing appropriate signal sequences

    • Consider co-expression with DsbC to enhance correct folding

  • Growth and Induction Conditions:

    • Rich media (such as 2YT or TB) typically provides better yields for initial trials

    • Lower temperatures (16-20°C) and longer induction times favor proper folding

    • IPTG concentrations between 0.1-0.5 mM are generally recommended

  • Strain Selection:

    • Consider specialized strains like Origami™ (with mutations in gor and trxB genes) or Shuffle™ (expressing cytoplasmic DsbC)

    • Standard expression strains like BL21(DE3) may be sufficient when targeting periplasmic expression

  • Lysis Methods:

    • Gentle lysis methods like osmotic shock preserve protein structure better than mechanical disruption

    • Enzymatic lysis with lysozyme can be effective for periplasmic extraction

Research has shown that these approaches have been successful for the production of various disulfide-rich proteins, including those with multiple disulfide bonds .

How can researchers distinguish between folding issues and expression problems when working with DsbD?

This is a critical distinction in troubleshooting recombinant DsbD production. Researchers should implement a systematic approach:

  • Sequential Protein Analysis:

    • Analyze total cell lysate, soluble fraction, and insoluble fraction by SDS-PAGE

    • Compare results under reducing vs. non-reducing conditions to assess disulfide formation

    • Use Western blotting with anti-DsbD antibodies or tag-specific antibodies for greater sensitivity

  • Location Assessment:

    • Perform cellular fractionation to separately analyze cytoplasmic, periplasmic, and membrane fractions

    • For DsbD specifically, substantial presence in the cytoplasmic fraction may indicate signal sequence processing issues

  • Functional Assays:

    • Test for DsbD activity using thiol-disulfide exchange assays

    • Assess the ability of expressed DsbD to complement dsbD-deficient strains

  • Folding Status Determination:

    • Analyze protein aggregation state using size exclusion chromatography

    • Assess secondary structure using circular dichroism spectroscopy

    • For more detailed analysis, limited proteolysis can determine if the protein maintains a folded conformation

Expression issues typically manifest as low yields across all fractions, while folding problems often present as adequate expression but with the protein predominantly in the insoluble fraction or lacking activity even when soluble.

How can DsbD be utilized to improve the expression of disulfide-rich heterologous proteins?

The DsbD-DsbC system can be leveraged to enhance correct folding of disulfide-rich heterologous proteins . Several research-validated strategies include:

  • Engineered Expression Systems:

    • Co-express DsbD with DsbC to enhance disulfide isomerization capacity

    • Utilize specialized E. coli strains with mutations affecting cytoplasmic redox state (e.g., Origami™ strains with gor and trxB mutations)

    • Consider the ShuffleTM strain that introduces cytoplasmic DsbC to enhance disulfide bond formation

  • Optimization of Periplasmic Targeting:

    • Test multiple signal sequences (pelB, DsbA, OmpA) to identify optimal periplasmic targeting

    • Ensure efficient signal sequence processing through codon optimization at the signal sequence junction

  • Expression Modulation:

    • Control expression rate through temperature reduction and promoter strength adjustment

    • Balance protein synthesis with the capacity of the disulfide formation machinery

  • Fusion Protein Strategies:

    • Create fusions with well-folded periplasmic proteins to enhance solubility

    • Include protease cleavage sites for removing fusion partners after folding

What approaches can be used to study the electron transfer mechanism of DsbD?

Studying DsbD's electron transfer mechanism requires specialized techniques to capture this dynamic process:

These approaches should be combined to develop a comprehensive model of DsbD's electron transfer mechanism, with particular attention to how electrons are transferred across the membrane domains.

What are common issues encountered when expressing recombinant DsbD, and how can they be resolved?

Researchers commonly encounter several challenges when working with recombinant DsbD:

IssuePotential CausesSolutions
Low expression yieldCodon usage bias, toxicity, protein instabilityOptimize codon usage, use weaker promoters, lower induction temperature, add stabilizing agents
Incorrect foldingFormation of non-native disulfide bonds, aggregationDirect expression to periplasm, co-express with DsbC, use specialized strains like Origami™ or ShuffleTM
Incomplete membrane insertionSignal sequence issues, overexpression overwhelming membrane machineryOptimize signal sequence, reduce expression rate, use milder induction conditions
Lack of activityIncorrect folding, loss of cofactors, inactive conformationInclude appropriate redox buffers during purification, ensure gentle purification methods, verify correct disulfide bond formation
Protein degradationProtease susceptibility, instabilityAdd protease inhibitors, use protease-deficient strains, optimize buffer conditions

For DsbD specifically, ensuring proper membrane integration while maintaining the functional conformation of all domains is critical. The protein's integrity can be assessed through activity assays measuring its ability to reduce DsbC or other electron acceptors.

How can researchers optimize periplasmic expression systems to enhance DsbD functionality?

Optimizing periplasmic expression for DsbD requires a systematic approach focused on the unique challenges of membrane proteins with redox activity:

  • Signal Sequence Optimization:

    • Test different periplasmic targeting sequences (OmpA, DsbA, pelB) to identify the most efficient

    • Consider creating a library of signal sequence variants with different processing efficiencies

  • Expression Regulation:

    • Implement tightly regulated expression systems to prevent premature protein aggregation

    • Use auto-induction media to achieve gradual protein expression

  • Redox Environment Manipulation:

    • Supplement growth media with redox-active compounds (glutathione, cysteine/cystine)

    • Adjust aeration conditions to influence periplasmic redox potential

  • Co-expression Strategies:

    • Co-express periplasmic chaperones (Skp, SurA, FkpA) to aid membrane protein folding

    • Consider co-expressing DsbC to enhance disulfide isomerization capacity

  • Extraction Optimization:

    • Develop gentle periplasmic extraction methods that preserve membrane protein structure

    • Test osmotic shock methods with varying osmolyte concentrations

The optimized approach should be validated through functional assays specific to DsbD activity, such as its ability to maintain DsbC in a reduced state for disulfide isomerization .

How is research on DsbD contributing to antibiotic discovery and development?

DsbD represents a potential antibiotic target due to its essential role in maintaining proper protein folding in many bacterial pathogens:

  • DsbD as a Direct Target:

    • The unique structure and essential function of DsbD in many pathogens make it an attractive antibiotic target

    • Inhibition of DsbD would disrupt the bacterial disulfide bond formation machinery, leading to accumulation of misfolded proteins

  • Structure-Based Drug Design Approaches:

    • Crystal structures of DsbD domains can guide rational design of inhibitors targeting critical interfaces

    • Virtual screening campaigns can identify compounds that interact with the electron transfer pathway

  • Assay Development for Drug Screening:

    • High-throughput assays measuring DsbD activity can be developed to screen compound libraries

    • Cell-based assays with reporter systems can identify compounds with cellular activity

  • Resistance Considerations:

    • Studies on the evolution of resistance to DsbD inhibitors can inform drug development strategies

    • Combination approaches targeting multiple components of the disulfide bond formation machinery may reduce resistance emergence

DsbD inhibition represents a novel antibiotic approach that targets a system distinct from traditional antibiotic targets like cell wall synthesis, protein synthesis, or DNA replication, potentially addressing issues of existing antibiotic resistance.

What emerging technologies are advancing our understanding of DsbD function and applications?

Several cutting-edge technologies are driving new insights into DsbD biology:

  • Cryo-Electron Microscopy:

    • Enables structural determination of full-length DsbD in membrane environments

    • Can capture different conformational states during the electron transfer cycle

  • Single-Molecule FRET:

    • Allows direct observation of conformational changes during electron transfer

    • Can provide insights into the dynamics of DsbD-substrate interactions

  • Nanodiscs and Liposome Reconstitution:

    • Enables study of DsbD in defined membrane environments

    • Allows precise control of redox conditions on either side of the membrane

  • Synthetic Biology Approaches:

    • Creation of minimized or enhanced DsbD variants for biotechnology applications

    • Development of synthetic electron transfer pathways incorporating DsbD components

  • Systems Biology Integration:

    • Multi-omics approaches linking DsbD function to global cellular physiology

    • Network analysis revealing novel interactions and regulatory mechanisms

These technologies collectively promise to advance both fundamental understanding of DsbD and its potential applications in protein production, synthetic biology, and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.