Recombinant Escherichia coli Type 4 prepilin-like proteins leader peptide-processing enzyme (gspO)

Shipped with Ice Packs
In Stock

Description

Functional Role in Secretion Systems

GspO plays a critical role in the post-translational modification of prepilin substrates:

  • Substrate Specificity: Processes Neisseria gonorrhoeae type IV prepilin and Klebsiella oxytoca prePulG protein .

  • Mechanism: Cleaves a glycine residue at the C-terminus of the leader peptide, followed by N-methylation of the newly exposed N-terminal phenylalanine .

  • Complementation: Restores pullulanase secretion in pulO-deficient K. oxytoca when expressed under the lacZ promoter .

Key Reaction:

Type IV prepilin+H2OGspOProcessed pilin+N-terminal phenylalanine-methylated peptide[3][5]\text{Type IV prepilin} + \text{H}_2\text{O} \xrightarrow{\text{GspO}} \text{Processed pilin} + \text{N-terminal phenylalanine-methylated peptide} \quad[3][5]

Cryptic Operon Expression

The gspC-O operon in E. coli K-12 is transcriptionally silent under standard laboratory conditions due to weak promoter activity . Key findings include:

  • Induced Expression: Overexpression of gspO via lacZ promoters enables functional complementation of pulO mutants and restores secretion in pulG-deficient strains .

  • Protein Processing: Recombinant GspO processes prePulG into its mature form, detectable via PulG-specific antisera .

Domain Architecture

  • Catalytic Domain: Contains conserved residues for metallopeptidase activity, critical for leader peptide cleavage .

  • Transmembrane Regions: Predicted to anchor the enzyme to the inner membrane .

Comparison with Homologs

FeatureGspO (E. coli)PulO (K. oxytoca)
Gene ExpressionCryptic (silent operon) Constitutively expressed
Substrate RangeBroad (type IV prepilins) Narrow (pullulanase-specific)
Enzyme ActivityIPTG-dependent induction Constitutive

Research Applications

  • Model System: Used to study the evolutionary conservation of T2SS and type IV pili machinery .

  • Biotechnological Use: Recombinant GspO facilitates studies on protein secretion mechanisms and enzyme engineering .

References to Key Studies

  1. Functional Complementation: Francetic et al. (1996) demonstrated GspO’s ability to substitute for PulO in pullulanase secretion .

  2. Cryptic Operon Analysis: Sequencing of the gspC-O operon revealed its homology to secretory pathways in K. oxytoca and Pseudomonas aeruginosa .

  3. Enzyme Characterization: BioCyc annotations confirm GspO’s role in prepilin processing and its membrane localization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
gspO; hofD; hopD; hopO; yheC; b3335; JW3297; Prepilin leader peptidase/N-methyltransferase [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
gspO
Target Protein Sequence
MTMLLPLFILVGFIADYFVNAIAYHLSPLEDKTALTFRQVLVHFRQKKYAWHDTVPLILC VAAAIACALAPFTPIVTGALFLYFCFVLTLSVIDFRTQLLPDKLTLPLLWLGLVFNAQYG LIDLHDAVYGAVAGYGVLWCVYWGVWLVCHKEGLGYGDFKLLAAAGAWCGWQTLPMILLI ASLGGIGYAIVSQLLQRRTITTIAFGPWLALGSMINLGYLAWISY
Uniprot No.

Target Background

Function
Recombinant Escherichia coli Type 4 prepilin-like proteins leader peptide-processing enzyme (gspO) plays a crucial role in type II pseudopili formation. It acts by proteolytically removing the leader sequence from substrate proteins and subsequently monomethylating the alpha-amino group of the newly exposed N-terminal phenylalanine. Substrates include proteins essential for the biogenesis of the type II general secretory apparatus.
Database Links
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the gspO gene in Escherichia coli and what is its functional role?

The gspO gene (also known as hofD, hopD, hopO, or yheC) is the last gene in the gsp operon of Escherichia coli K-12 . It encodes a protein that functions as a type IV prepilin peptidase, responsible for cleaving the leader peptides from type IV prepilin-like proteins . The enzyme catalyzes the reaction where type IV prepilin and water produce a protein C-terminal glycine and an N-terminal L-phenylalanyl-type IV prepilin .

The gspO enzyme is a critical component of the cryptic type II secretion system in E. coli K-12, and although present in the genome, it is typically not expressed under standard laboratory conditions due to very weak transcription from the upstream region . When artificially expressed from lacZp promoter, the gspO gene product has been demonstrated to cleave known prepilin peptidase substrates, including Neisseria gonorrhoeae type IV prepilin and Klebsiella oxytoca prePulG protein .

How is the expression of gspO regulated in E. coli K-12?

The expression of the gspO gene in E. coli K-12 is highly regulated and appears to be silenced under normal laboratory conditions. Research has shown that the chromosomal copy is apparently not expressed, likely due to very weak transcription from the upstream region . This has been measured using a chromosomal gspC-lacZ operon fusion, which confirmed minimal transcriptional activity .

When researchers want to study the functional aspects of gspO, they typically express it from an inducible promoter such as lacZp. Under these artificial expression conditions, the gspO product demonstrates functional activity, suggesting that the lack of expression is due to transcriptional silencing rather than protein dysfunction .

The cryptic nature of the entire gsp operon suggests an evolutionary adaptation where these genes are maintained in the genome but activated only under specific environmental conditions that are not typically encountered in laboratory settings.

What methodology can be used to detect gspO enzyme activity?

To detect and measure gspO enzyme activity, researchers can employ several complementary approaches:

  • Complementation Assays: Expression of gspO from an inducible promoter like lacZp can complement mutations in homologous genes such as pulO in the Klebsiella oxytoca pullulanase secretion system . This functional complementation provides evidence of enzymatic activity.

  • Substrate Processing Detection: The activity can be monitored by tracking the cleavage of known substrates such as Neisseria gonorrhoeae type IV prepilin and K. oxytoca prePulG protein . This typically involves:

    • Expressing the substrate protein in E. coli cells

    • Co-expressing gspO or leaving it unexpressed (control)

    • Using SDS-PAGE and immunoblotting to detect the size shift that occurs upon leader peptide cleavage

  • Immunological Detection: Using antibodies against processed prepilin substrates, such as PulG-specific antiserum or antiserum against homologous proteins like the Pseudomonas aeruginosa XcpG (formerly XcpT) .

What is the relationship between gspO and antibiotic resistance mechanisms in E. coli?

Recent genomic analyses have revealed potential connections between the type II secretion system (including gspO) and antibiotic resistance in E. coli. A study analyzing cefotaxime (CTX) resistance identified that mutations in components of the type II secretion system were associated with CTX resistance traits .

Specifically, multiple mutations were found in genes of the type II secretion system that correlate with CTX resistance. While most of these mutations were synonymous, a missense mutation in the gspL gene (resulting in Ser330Thr alteration) was significantly associated with CTX resistance . The gspL gene encodes another component of the same secretion system that includes gspO.

Researchers hypothesize that these mutations might represent secondary adaptations needed to cope with elevated AmpC production, as the peptidoglycan layer is affected by AmpC hyperproduction, and the type II secretion system contains proteins that are partly localized in the periplasm . This suggests a complex interplay between the type II secretion system components and antibiotic resistance mechanisms.

How can homoplasy and recombination analysis inform the study of gspO evolution?

Homoplasy and recombination analyses provide valuable tools for understanding the evolutionary history and significance of genes like gspO. In a genome-wide analysis of E. coli strains:

For studying gspO and the type II secretion system, these analyses have revealed that while some components show extreme homoplasy levels, this is likely due to recombination rather than convergent evolution . The recombination blocks cover regions including type II secretion system genes, suggesting horizontal gene transfer plays a role in their evolution .

What experimental approaches can be used for functional characterization of recombinant gspO?

For comprehensive functional characterization of recombinant gspO, researchers can employ these methodological approaches:

  • Heterologous Expression Systems:

    • Express gspO from inducible promoters (e.g., lacZp) in E. coli laboratory strains

    • Optimize expression conditions to ensure proper membrane localization

    • Include appropriate tags for purification while ensuring they don't interfere with function

  • Substrate Specificity Analysis:

    • Express various potential substrates alongside gspO

    • Monitor processing through SDS-PAGE, western blotting, and mass spectrometry

    • Create a panel of mutated substrates to map recognition motifs

  • Structure-Function Analysis:

    • Generate site-directed mutants of conserved residues

    • Assess functional impact on substrate processing

    • Correlate with structural predictions or determined structures

  • Membrane Topology Analysis:

    • Use reporter fusions (PhoA/LacZ) to map membrane orientation

    • Employ protease accessibility assays to determine exposed domains

    • Use fluorescent protein fusions to visualize localization

What are the key interactions between gspO and other components of the type II secretion system?

The type II secretion system (T2SS) in bacteria involves complex protein-protein interactions. Although the cryptic nature of the gsp operon in E. coli K-12 has limited direct studies, research on homologous systems provides insights into gspO's interactions:

  • Interaction with Prepilin Substrates: The gspO enzyme specifically recognizes and processes type IV prepilin-like proteins, including the gspG gene product . When both gspG and gspO are expressed, gspO processes the gspG product into its mature form.

  • Functional Relationships in the Secretion Machinery: The processed prepilins form a pseudopilus structure that is essential for the function of the secretion machinery. The processing of these prepilins by gspO is a crucial first step in the assembly of this structure.

  • System Integration: While gspO functions primarily as a peptidase, its activity must be coordinated with other T2SS components. The proper assembly and function of the T2SS require that components be expressed in appropriate ratios and localized correctly within the bacterial cell envelope.

  • Potential Regulatory Interactions: The silencing of the gsp operon under laboratory conditions suggests potential interactions with regulatory proteins that control its expression in response to specific environmental signals.

What are the challenges in purifying and maintaining enzymatic activity of recombinant gspO?

Purifying and maintaining the activity of recombinant gspO presents several technical challenges:

  • Membrane Protein Solubilization: As an inner membrane protein , gspO requires appropriate detergents for extraction and solubilization. Common challenges include:

    • Finding detergents that maintain native structure

    • Balancing detergent concentration to avoid protein aggregation

    • Preserving enzyme activity during solubilization

  • Expression Systems Options:

Expression SystemAdvantagesLimitations
E. coli with T7 promoterHigh yield, simple protocolPotential toxicity, inclusion body formation
E. coli with arabinose promoterTighter regulation, lower basal expressionModerate yield
Cell-free systemsAvoids toxicity issuesLower yield, higher cost
Yeast or insect cellsBetter for membrane proteinsMore complex, longer timeframe
  • Assay Development: Developing reliable activity assays is challenging because:

    • The enzyme's natural substrates in E. coli are poorly expressed

    • Synthetic peptide substrates may not accurately reflect native specificity

    • Monitoring cleavage often requires specialized detection methods

How can evolutionary analysis inform functional studies of gspO across bacterial species?

Evolutionary analysis provides valuable context for functional studies of gspO across different bacterial species:

  • Sequence Conservation Analysis:

    • Conserved residues across diverse species likely represent functionally critical amino acids

    • Variable regions may indicate adaptation to different substrate specificities

    • Phylogenetic clustering can reveal functional diversification

  • Synteny Analysis:

    • The organization of the gsp operon varies across bacterial species

    • In E. coli K-12, the gsp operon (gspC-O) appears complete but cryptic

    • Other bacteria may have different arrangements reflecting functional specialization

  • Homology Modeling:

    • Structure prediction based on homologous proteins

    • Identification of catalytic sites and substrate binding regions

    • Prediction of membrane topology and protein-protein interaction interfaces

  • Functional Transfer Testing:

    • The E. coli gspO can complement mutations in the corresponding gene (pulO) of K. oxytoca

    • Testing cross-species complementation can reveal functional conservation

    • Identification of species-specific determinants through domain swapping experiments

What protocols are most effective for inducing expression of the cryptic gspO gene?

The cryptic nature of the gspO gene presents challenges for researchers seeking to study its function. Several methodological approaches have proven effective:

  • Heterologous Promoter Replacement:

    • Placing gspO under control of inducible promoters such as lacZp has been demonstrated to yield functional expression

    • IPTG-inducible systems allow for controlled expression levels

    • Arabinose-inducible systems offer tighter regulation with less leaky expression

  • Environmental Condition Screening:

    • Systematic testing of various stress conditions (pH, temperature, osmolarity)

    • Monitoring expression using reporter gene fusions (e.g., gspO-lacZ)

    • High-throughput approaches to identify natural induction signals

  • Genetic Background Manipulation:

    • Screening for mutations that derepress the gsp operon

    • Testing expression in various regulatory mutants (e.g., hns mutants)

    • Introduction of plasmid-borne copies with native regulatory elements in multicopy

  • CRISPR-Based Activation:

    • Using modified CRISPR-Cas9 systems (CRISPRa) to recruit transcriptional activators

    • Targeting the native gspO promoter region to enhance expression

    • Combinatorial approaches targeting multiple regulatory elements

How can researchers effectively study the substrate specificity of gspO?

Understanding the substrate specificity of gspO requires methodical approaches:

  • Known Substrate Testing:

    • Express known substrates like N. gonorrhoeae type IV prepilin and K. oxytoca prePulG alongside gspO

    • Monitor processing using SDS-PAGE and immunoblotting

    • Compare processing efficiency across different substrates

  • Proteomics-Based Identification:

    • Compare the proteome of E. coli expressing active versus inactive gspO

    • Identify proteins with altered molecular weights indicating processing

    • Use mass spectrometry to map precise cleavage sites

  • Synthetic Peptide Libraries:

    • Create libraries of peptides representing potential cleavage motifs

    • Screen for processing using fluorescence-based assays

    • Develop quantitative structure-activity relationships

  • Mutagenesis of Substrate Recognition Sequences:

    • Systematic mutation of amino acids flanking the cleavage site

    • Analysis of processing efficiency for each variant

    • Determination of consensus recognition sequences

What are the most promising future research directions for gspO?

Based on current knowledge, several promising research directions emerge:

  • Structural Biology Approaches:

    • Determination of the three-dimensional structure of gspO

    • Structural comparison with homologous enzymes

    • Structure-guided drug design targeting type IV prepilin peptidases

  • Systems Biology Integration:

    • Comprehensive mapping of the gspO interactome

    • Integration of gspO function in whole-cell models

    • Multi-omics approaches to understand regulation

  • Biotechnological Applications:

    • Development of gspO as a tool for recombinant protein processing

    • Engineering substrate specificity for novel applications

    • Creation of biosensors based on gspO activity

  • Clinical Relevance Exploration:

    • Further investigation of the link between type II secretion system and antibiotic resistance

    • Exploration of gspO as a potential antimicrobial target

    • Understanding the role of gspO in pathogenic E. coli strains versus commensal strains

How might understanding gspO function contribute to broader knowledge in bacterial secretion systems?

The study of gspO provides insights into fundamental aspects of bacterial physiology:

  • Evolutionary Conservation and Divergence:

    • Understanding why E. coli K-12 maintains a cryptic but functional gsp operon

    • Comparison with actively expressed homologs in other species

    • Insights into the evolution of specialized secretion systems

  • Regulatory Network Integration:

    • Mapping the signals that might naturally induce gspO expression

    • Understanding cross-talk between different secretion systems

    • Identification of master regulators controlling multiple secretion pathways

  • Structural Homology Applications:

    • Using insights from gspO to understand related enzymes

    • Application of knowledge to type II secretion systems in pathogens

    • Development of broad-spectrum inhibitors of type IV prepilin peptidases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.