Recombinant Escherichia coli Tyrosine-protein kinase etk (etk)

Shipped with Ice Packs
In Stock

Description

Introduction

Escherichia coli tyrosine kinase (Etk), also known as Ep85, is a bacterial protein tyrosine kinase (PTK) found in Escherichia coli . PTKs are enzymes that play crucial roles in cell signaling by catalyzing the transfer of phosphate groups to tyrosine residues on target proteins . While tyrosine phosphorylation is well-understood in eukaryotes, it was initially considered rare and poorly defined in bacteria . Etk is involved in regulating the synthesis, polymerization, and translocation of exopolysaccharides (EPS) or capsular polysaccharides (CPS), which are important for bacterial virulence .

Identification and Characterization of Etk

The etk gene encodes an inner membrane protein that catalyzes tyrosine autophosphorylation and phosphorylation of a synthetic copolymer poly(Glu:Tyr) . The etk gene was identified while studying the virulence aspects of enteropathogenic E. coli (EPEC) . Researchers noticed a protein, Ep85, that reacted with anti-phosphotyrosine antibodies. The N-terminal amino acid sequence of Ep85 matched the sequence of a putative protein YccC encoded by an open reading frame (ORF) in the E. coli K12 MG1655 genome .

Key characteristics of Etk:

  • Size: Approximately 80.5-81.2 kDa

  • Activity: Catalyzes tyrosine autophosphorylation

  • Regulation: Expression and post-translational modifications are dynamic during EPEC growth

  • Homology: Etk is homologous to other bacterial proteins, such as Ptk of Acinetobacter johnsonii, AmsA of Erwinia amylovora, and Orf6 of Klebsiella pneumoniae .

Functional Role in Capsule Biosynthesis and Antibiotic Resistance

Etk, along with other BY-kinases such as Wzc, regulates the translocation assemblies of Group-1 CPS, Group-4 CPS, and colonic acid EPS in E. coli . Specifically, Etk is involved in the formation of group 4 capsules, with cycles of phosphorylation and dephosphorylation being crucial for this process . Studies using etk-knockout E. coli cells showed compromised resistance to polymyxin-B. Complementation experiments with full-length Etk mutants demonstrated that the interaction between phosphorylated Y574 and R614 is essential for activation and polymyxin-B resistance .

Expression and Distribution

The etk gene is present in all E. coli strains examined, but its expression varies among different strains . Etk is expressed by a subset of pathogenic strains of E. coli, including EPEC and ETEC, suggesting its potential role in virulence mechanisms .

Recombinant Protein Production

Escherichia coli is a widely used host for recombinant protein production due to its well-established use as a cell factory, a vast catalog of expression plasmids, engineered strains, and cultivation strategies . Optimizing the transcription of heterologous genes is essential to avoid drawbacks such as the formation of inclusion bodies, metabolic burden, or inefficient translocation of expressed proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
etk; yccC; b0981; JW0964; Tyrosine-protein kinase etk
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-726
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
etk
Target Protein Sequence
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADT LVQVEQKQGNAILSGLSDMIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPI VGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGENGHYTLEGEEFTVNGMVGQRL EKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSV DLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNK RVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPV KPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGAT PDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKV IQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVV GRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY SYSEKE
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies indicate that protein kinase Wzc is not essential for polymyxin resistance, while protein kinase Etk plays a crucial role in this antibiotic resistance mechanism. [PMID: 16814990](https://www.ncbi.nlm.nih.gov/pubmed/16814990)
  2. The proposed Etk activation mechanism involves the unblocking of the enzyme's active site via conformational change of the phosphorylated tyrosine 574 side chain. [PMID: 19634880](https://www.ncbi.nlm.nih.gov/pubmed/19634880)
Database Links
Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Note=When the protein is overexpressed.

Q&A

What is the structural organization of Escherichia coli Tyrosine-protein kinase etk?

Etk represents a bacterial protein tyrosine kinase with a unique structural organization that differs significantly from eukaryotic PTKs. The crystal structure of the Etk kinase domain (residues 451-726) reveals a single-domain scaffold consisting of a central, eight-stranded, predominantly parallel β-sheet surrounded by 13 helices of varying lengths . The active site contains well-conserved ATP-binding Walker motifs and is located at the end of the long E-helix and the loop regions that follow strands 3 and 6 .

Notably, structural homology searches using Dali indicated that Etk does not share significant structural similarity with eukaryotic tyrosine kinases, confirming it belongs to a distinct family of bacterial PTKs . Etk is an inner membrane protein capable of catalyzing tyrosine autophosphorylation and phosphorylation of synthetic substrates like poly(Glu:Tyr) .

How does Etk distribution and expression vary among E. coli strains?

While the etk gene is present in all E. coli strains examined, expression of the protein varies significantly. Research has demonstrated that only a subset of pathogenic strains actively express Etk . This selective expression pattern suggests Etk may play important roles in pathogenicity.

Analysis of diverse E. coli isolates shows that Etk expression correlates with virulence factors. The protein is commonly found in enteropathogenic E. coli (EPEC) strains but is generally not expressed in laboratory K12 strains under standard growth conditions . This differential expression pattern provides researchers with important experimental considerations when selecting appropriate strains for Etk studies.

What is the activation mechanism of Etk and how does it differ from eukaryotic kinases?

Etk employs a unique activation mechanism fundamentally different from eukaryotic protein tyrosine kinases. In its inactive state, the tyrosine residue Y574 blocks the active site through steric hindrance. Upon phosphorylation of Y574, a critical interaction forms between phosphorylated Y574 (P-Y574) and arginine R614, which pulls the tyrosine side chain away from the active site, unblocking it and enabling substrate access .

This mechanism differs from eukaryotic PTKs in several key aspects:

  • The activation involves minimal conformational change - primarily the movement of a single side chain rather than large domain shifts

  • The main-chain loop prior to Y574 is rigid, unlike the flexible activation loops in mammalian kinases

  • The active site remains enclosed from the sides, with substrate access from the protein surface

This localized nature of the conformational change—involving just the rearrangement of a single side chain—represents a novel PTK activation model distinct from eukaryotic counterparts. Mutation studies confirm this mechanism, as Y574A (eliminating steric hindrance), Y574E (mimicking phosphorylation), and R614K (maintaining interaction capability) mutants show higher activity than Y574F, Y574N, or R614A mutants that compromise the P-Y574-R614 activation switch .

What role does Etp play in regulating Etk phosphorylation?

Etk activity is regulated through a phosphorylation-dephosphorylation cycle involving the bacterial phosphotyrosine phosphatase Etp. Research has demonstrated that overexpression of Etp results in a clear decrease in tyrosine-phosphorylated Etk in vivo . This evidence suggests that Etp specifically dephosphorylates Etk, providing a regulatory mechanism for controlling Etk activity in the cell.

The Etp-mediated dephosphorylation likely targets the critical Y574 residue, thus returning Etk to its inactive state where Y574 blocks the active site. This cycling between phosphorylated (active) and dephosphorylated (inactive) states allows precise control over Etk-dependent cellular processes .

What are the optimal methods for cloning and expressing recombinant Etk?

For successful cloning and expression of recombinant Etk, researchers should consider the following methodological approach:

  • Gene amplification: Design primers based on the etk gene sequence of E. coli. The primers should include appropriate restriction sites (e.g., BamHI and HindIII) for subsequent cloning .

  • Expression vector selection: Use vectors with regulated promoters like pQE31 with a Ptac promoter. Adding a hexahistidine (6His) tag facilitates subsequent purification. Importantly, strong overexpression of Etk can be toxic to E. coli, so regulated expression systems are essential .

  • Expression regulation: To avoid toxicity issues, incorporate the lacI gene into the expression system to enable better regulation of expression levels. This approach was successfully used to generate pOI194 from pEP19 .

  • Growth conditions: Consider reduced temperature (20-25°C) and lower induction levels to enhance protein solubility and reduce toxicity.

  • Purification strategy: Utilize affinity chromatography with anti-phosphotyrosine antibodies or Ni-NTA resin (for His-tagged constructs) for protein purification .

What in vivo systems can be used to assess Etk function?

Several in vivo experimental systems have been developed to assess Etk function:

  • Antibiotic resistance assays: Polymyxin-B resistance assays provide a functional readout for Etk activity. In etk-knockout E. coli cells, polymyxin-B resistance is compromised, and this phenotype can be rescued by wild-type Etk or constitutively active variants . The table below summarizes the relative polymyxin-B resistance of different Etk variants:

Etk VariantMutation EffectPolymyxin-B Resistance
Wild-typeNormal function++++
Y574AAbsence of steric hindrance+++++
Y574EPhosphomimetic (always "on")+++++
R614KMaintains P-Y574 interaction++++
Y574FCompromised P-Y574-R614 switch++
Y574NCompromised P-Y574-R614 switch++
R614ACompromised P-Y574-R614 switch++
KnockoutNo Etk expression+
  • Exopolysaccharide production: Since Etk regulates EPS/CPS production, assays measuring capsule formation or EPS secretion can assess Etk function. Group-1 and Group-4 capsules in E. coli use a Wzy-dependent polymerization system that depends on Etk activity .

  • Phosphorylation analysis: Western blot analysis using anti-phosphotyrosine antibodies can directly assess Etk phosphorylation status in various genetic backgrounds and experimental conditions .

How does Etk contribute to bacterial virulence mechanisms?

Etk plays a critical role in bacterial virulence through several mechanisms:

  • Exopolysaccharide regulation: Etk is involved in the production of exopolysaccharide (EPS) and capsular polysaccharide (CPS), which are essential virulence factors that protect bacteria from host defenses. Specifically, Etk regulates Group-4 CPS polymerization and translocation in E. coli isolates that cause intestinal infections .

  • Trans-envelope complex coordination: Etk participates in a novel trans-envelope complex that coordinates the synthesis and translocation of EPS/CPS through phosphorylation/dephosphorylation cycles. This complex is crucial for establishing the protective outer layer of pathogenic bacteria .

  • Antibiotic resistance: Etk activity contributes to polymyxin-B resistance, as demonstrated by the compromised resistance in etk-knockout E. coli cells. This resistance to antimicrobial peptides enhances bacterial survival during infection .

  • Potential protein substrate regulation: While the full range of Etk substrates remains to be identified, BipA/TypA has been suggested as a specific Etk substrate. BipA is tyrosine phosphorylated in EPEC but not in K12 strains, suggesting Etk-dependent modification may regulate BipA's function in virulence .

The importance of Etk in virulence is further supported by the observation that its homologues in other pathogens, such as AmsA in Erwinia amylovora and Orf6 in Klebsiella pneumoniae, are also PTKs involved in EPS production required for virulence .

What are the key structural differences between bacterial Etk and eukaryotic tyrosine kinases?

Bacterial Etk represents a distinct protein family that differs significantly from eukaryotic PTKs in several key aspects:

These significant structural and mechanistic differences between bacterial and eukaryotic PTKs highlight the potential of Etk as a specific target for antibacterial drug development.

Why might recombinant Etk show low activity in vitro and how can this be addressed?

Several factors can contribute to low activity of recombinant Etk in vitro:

  • Phosphorylation status: Since Etk activity depends on Y574 phosphorylation, insufficient autophosphorylation during expression may result in predominantly inactive protein. To address this:

    • Co-express Etk with tyrosine kinases to enhance phosphorylation

    • Include ATP and Mg²⁺ in purification buffers to promote autophosphorylation

    • Use phosphomimetic mutations (Y574E) to simulate the active state

  • Protein folding and stability: Membrane proteins like Etk often face folding challenges when expressed recombinantly. Consider:

    • Lowering expression temperature (20-25°C)

    • Using solubility-enhancing fusion tags

    • Including appropriate detergents for membrane protein solubilization

    • Testing different E. coli expression strains optimized for membrane proteins

  • Toxicity effects: Overexpression of Etk can be toxic to E. coli, potentially selecting for lower-expressing or inactive variants. Strategies include:

    • Using tightly regulated expression systems (e.g., with lacI gene)

    • Pulse-expression approaches with shorter induction times

    • Testing expression in etk-knockout strains to avoid interference from endogenous protein

  • Assay conditions: Optimize in vitro kinase assay conditions by:

    • Testing different pH values, salt concentrations, and divalent cations

    • Ensuring appropriate substrate accessibility

    • Including phosphatase inhibitors to prevent dephosphorylation by co-purifying phosphatases

What strategies can be employed to identify physiological substrates of Etk?

Identifying the physiological substrates of Etk represents a significant challenge. The following methodological approaches can be employed:

  • Candidate approach: Based on knowledge that BipA/TypA may be a specific Etk substrate, similar proteins can be tested. BipA is tyrosine phosphorylated in EPEC but not in K12 strains, suggesting Etk-dependent modification .

  • Phosphoproteomics: Compare the phosphotyrosine proteome of wild-type and etk-knockout strains using:

    • Enrichment of phosphotyrosine-containing proteins using anti-phosphotyrosine antibodies

    • Stable isotope labeling with amino acids in cell culture (SILAC) for quantitative comparison

    • Mass spectrometry analysis to identify differentially phosphorylated proteins

  • In vitro kinase assays: Screen potential substrates using:

    • Protein microarrays containing bacterial proteins

    • Synthetic peptide libraries representing common phosphorylation motifs

    • Co-immunoprecipitation followed by kinase assays to identify interacting proteins

  • Genetic approaches: Use suppressor screens or synthetic lethal screens to identify genes functionally related to etk, which may encode substrate proteins or regulatory partners.

  • Structural prediction: Use the crystal structure of Etk to model substrate binding and predict proteins with compatible interaction surfaces.

The combination of these approaches should help identify the full range of physiological substrates and provide insights into the diverse cellular functions of Etk.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.