Recombinant Escherichia coli Tyrosine-protein kinase wzc (wzc)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Escherichia coli Tyrosine-Protein Kinase Wzc (Wzc)

Recombinant Escherichia coli Tyrosine-protein kinase Wzc (Wzc) is a protein-tyrosine kinase found in Escherichia coli . Wzc participates in the export of the extracellular polysaccharide colanic acid from the cell to the medium . It can be produced in various hosts, including yeast, E. coli, baculovirus, and mammalian cells, through recombinant technology .

Characteristics and Function

  • Tyrosine Kinase Activity Wzc exhibits autophosphorylating protein-tyrosine kinase activity . It modifies itself exclusively at tyrosine residues . Phosphorylation of Tyr(569) leads to increased protein kinase activity, enabling Wzc to phosphorylate the five terminal tyrosines .

  • Role in Polysaccharide Production Wzc is involved in the production of capsular (CPS) and released (RPS) polysaccharides . It functions as an inner membrane protein with an ATP-binding domain and predicted transmembrane segments .

  • Interaction with Wzb Wzc interacts with Wzb, a phosphotyrosine-protein phosphatase also found in E. coli . Wzb can dephosphorylate Wzc, suggesting a regulatory mechanism connected with reversible protein phosphorylation on tyrosine .

Production and Availability

Recombinant Wzc can be produced in different expression systems :

  • E. coli: Recombinant Wzc can be expressed in E. coli .

  • Yeast: Yeast is also used as a host for the production of recombinant Wzc .

  • Baculovirus: This system is used for producing recombinant Wzc .

  • Mammalian Cells: Recombinant Wzc can be expressed in mammalian cells .

Research Findings

  • Identification of Wzc and Wzb The study by Grangeasse, et al. demonstrated that E. coli cells contain both a protein-tyrosine kinase (Wzc) and a phosphotyrosine-protein phosphatase (Wzb) . Wzb can utilize Wzc as an endogenous substrate, suggesting a regulatory mechanism involving reversible protein phosphorylation on tyrosine .

  • Structural Analysis Research has provided structural insights into the recognition of bacterial tyrosine kinases by counteracting phosphatases . Specific residues in Wzc and Wzb are crucial for their interaction .

  • Role in EPS Production Studies have shown that Wzc and Wzb influence the amount and composition of extracellular polymeric substances (EPS) in cyanobacteria . Wzb can dephosphorylate Wzc in vitro, indicating a role in cyanobacterial EPS production .

Potential Applications

Recombinant enzymes like Wzc have various applications, particularly in diagnostics and drug discovery :

  • Diagnostic Applications Recombinant enzymes enhance the sensitivity, specificity, and robustness of diagnostic assays, enabling the detection of low-abundance targets in complex biological samples .

  • Drug Discovery Recombinant enzymes are useful in in vitro assays for reaction phenotyping and enzyme inhibition studies . They can help study interactions between drug candidates and individual enzymes .

Table: Wzc and Wzb Characteristics

PropertyWzcWzb
FunctionAutophosphorylating protein-tyrosine kinasePhosphotyrosine-protein phosphatase
ActivityPhosphorylates tyrosine residuesDephosphorylates phosphotyrosine
SubstrateCan be dephosphorylated by WzbActs on Wzc as an endogenous substrate
RoleInvolved in colanic acid export and EPS productionRegulates Wzc activity
Cellular LocationInner membrane proteinCytoplasmic
Expression SystemE. coli, Yeast, Baculovirus, Mammalian CellsE. coli
InteractionInteracts with Wzb for reversible protein phosphorylation on tyrosineInteracts with Wzc to catalyze its dephosphorylation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
wzc; b2060; JW2045; Tyrosine-protein kinase wzc
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-720
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
wzc
Target Protein Sequence
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITTVFALCAVVYTFFATPIYSADA LVQIEQNSGNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPI FGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNKNYTLSSDGGFSARGQAGQML KKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSV DLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNG RVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAITQPGVL KPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGK TFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTS IAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVG TTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
Uniprot No.

Target Background

Function
Essential for colanic acid, an extracellular polysaccharide. The autophosphorylated form is inactive. It is likely involved in colanic acid export from the cell. It also phosphorylates UDG.
Gene References Into Functions
  1. Mutational analysis reveals a conserved EX(2)RX(2)R motif crucial for subunit interactions and polysaccharide export. PMID: 20633230
  2. Wzc protein interactions form a tetrameric complex necessary for assembling *Escherichia coli* group 1 capsules. PMID: 16172129
Database Links
Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.