Recombinant Escherichia coli Uncharacterized membrane protein YjcC (yjcC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pdeC; yjcC; b4061; JW4022; Probable cyclic di-GMP phosphodiesterase PdeC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pdeC
Target Protein Sequence
MSHRARHQLLALPGIIFLVLFPIILSLWIAFLWAKSEVNNQLRTFAQLALDKSELVIRQA DLVSDAAERYQGQVCTPAHQKRMLNIIRGYLYINELIYARDNHFLCSSLIAPVNGYTIAP ADYKREPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWSEVMSDDPTLQWGVYDTV TKTFFSLSKEASAATFSPLIHLKDLTVQRNGYLYATVYSTKRPIAAIVATSYQRLITHFY NHLIFALPAGILGSLVLLLLWLRIRQNYLSPKRKLQRALEKHQLCLYYQPIIDIKTEKCI GAEALLRWPGEQGQIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSI NLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAFLDVDKMTPIILAFRQAGYEVA IDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTSHLIAEHIIELAHSLGLKTIAEG VETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWMEQLPARELTRGQ
Uniprot No.

Target Background

Function

Recombinant Escherichia coli Uncharacterized Membrane Protein YjcC (yjcC)

This phosphodiesterase (PDE) catalyzes the hydrolysis of cyclic-di-GMP (c-di-GMP) to 5'-pGpG. c-di-GMP is a bacterial second messenger regulating cell surface traits. Overexpression of YjcC has been shown to reduce biofilm formation.

Database Links

KEGG: ecj:JW4022

STRING: 316407.85676813

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YjcC protein and what are its basic functions?

YjcC is a membrane protein in Escherichia coli that functions primarily as a cyclic di-GMP phosphodiesterase (PDE). The protein is 528 amino acids in length and is encoded by the yjcC gene (also known as pdeC) . As a phosphodiesterase, YjcC degrades cyclic di-GMP, an important bacterial second messenger molecule that regulates various cellular processes including biofilm formation, motility, and virulence .

The functional characterization of YjcC has demonstrated its role in bacterial stress responses, particularly under oxidative stress conditions. Expression studies have shown that YjcC is an in vivo expression (IVE) gene whose transcription is influenced by stress response regulatory pathways involving SoxRS and RpoS . The protein's ability to modulate intracellular c-di-GMP levels suggests it plays a significant role in bacterial adaptation to environmental stressors.

Methodology for studying YjcC basic function typically involves:

  • Gene knockout studies to observe phenotypic changes

  • Complementation assays to confirm gene function

  • Measurement of intracellular c-di-GMP levels using HPLC or mass spectrometry

  • Phosphodiesterase activity assays using purified recombinant protein

What domains are present in YjcC protein and what are their functions?

YjcC protein contains several distinct domains that contribute to its function and regulation:

DomainPositionFunctionDetection Method
TransmembraneN-terminal regionMembrane anchoringHydropathy analysis, membrane fractionation
EALC-terminal regionPhosphodiesterase activityEnzymatic assays, structural analysis
Sensory domainCentral regionEnvironmental sensingProtein-ligand binding studies

The EAL domain is the catalytic core of YjcC responsible for phosphodiesterase activity. This domain hydrolyzes cyclic di-GMP to 5'-phosphoguanylyl-(3'-5')-guanosine (pGpG) . Experimental evidence from in vitro studies using the purified EAL domain demonstrates its ability to degrade artificial substrates like para-nitrophenyl phosphate (pNpp), with activity levels higher than control constructs with mutated catalytic sites (AAL) .

The sensory domains likely function in environmental signal detection, particularly oxidative stress signals, as YjcC activity increases following exposure to oxidative agents like paraquat . This suggests a mechanism whereby environmental stressors trigger conformational changes that modulate the phosphodiesterase activity of the EAL domain.

How is the expression of YjcC regulated in Escherichia coli?

The regulation of YjcC expression involves multiple transcription factors and stress response pathways:

RegulatorEffect on YjcCExperimental EvidenceCondition
RpoS (σ^38)Positive regulationGene expression analysisStationary phase, stress
SoxRSPositive regulationTranscriptional studiesOxidative stress
FNRPotential regulationConserved binding site identifiedAnaerobic conditions

YjcC expression is RpoS-dependent in E. coli, consistent with its role in stress response . The SoxRS regulatory system, which responds to superoxide stress, also influences YjcC expression at the transcriptional level. Although no direct SoxRS or RpoS binding boxes have been identified within the YjcC promoter region, suggesting the possibility of indirect control mechanisms .

Interestingly, the presence of a conserved FNR (fumarate and nitrate reduction) binding box in the upstream non-coding region of yjcC suggests potential regulation by FNR, a transcription factor that controls the transition between aerobic and anaerobic growth . This implies that YjcC expression may also be modulated in response to oxygen availability, potentially linking redox sensing to c-di-GMP signaling.

What is the relationship between YjcC and c-di-GMP signaling?

YjcC plays a crucial role in c-di-GMP signaling networks through its phosphodiesterase activity:

RoleEffectExperimental Evidence
c-di-GMP degradationReduces intracellular c-di-GMP levelsIncreased c-di-GMP in ΔyjcC mutants
Stress response modulationEnhanced PDE activity under oxidative stressSignificant c-di-GMP reduction after paraquat exposure
Phenotypic regulationAffects biofilm formation and motilityPhenotypic analysis of deletion mutants

Experimental evidence demonstrates that deletion of the yjcC gene results in increased intracellular c-di-GMP levels, while complementation with wild-type YjcC significantly reduces c-di-GMP concentration . The difference in c-di-GMP levels between wild-type and mutant strains becomes more pronounced after exposure to oxidative stress inducers like paraquat, indicating that YjcC activity is enhanced under stress conditions .

The ability of YjcC to modulate c-di-GMP levels connects it to numerous bacterial behaviors regulated by this second messenger, including biofilm formation, motility, and virulence. Research methodologies for studying this relationship typically involve quantification of intracellular c-di-GMP using liquid chromatography-mass spectrometry (LC-MS), phenotypic analysis of yjcC mutants, and complementation studies using various YjcC constructs.

What experimental methods can be used to study YjcC phosphodiesterase activity?

Multiple experimental approaches can be employed to characterize YjcC phosphodiesterase activity:

MethodMeasurementAdvantagesLimitations
pNpp assayColorimetric detection of p-nitrophenolSimple, high-throughputLower specificity for c-di-GMP
HPLC-MSDirect measurement of c-di-GMP hydrolysisHigh specificity, quantitativeComplex equipment, lower throughput
FRET-based assaysReal-time activity monitoringKinetic analysis possibleRequires specialized probes
Radiolabeled substrateSensitive detection of activityHigh sensitivityRegulatory requirements, waste disposal

For in vitro characterization, recombinant expression and purification of the EAL domain or full-length YjcC is typically performed. Studies have successfully expressed and purified the EAL domain, demonstrating its activity against artificial substrates like pNpp . The catalytic activity can be compared to control constructs (such as the catalytically inactive AAL variant) to confirm specificity.

For in vivo assessment, complementation of yjcC deletion strains with wild-type or mutant variants allows for the evaluation of protein function in its native context. Intracellular c-di-GMP levels can be measured using HPLC-MS methods, and phenotypic outcomes (biofilm formation, motility) can be quantified using standard microbiological techniques.

Enzyme kinetic analysis can provide detailed insights into YjcC catalytic properties, including substrate affinity (Km), turnover rate (kcat), and inhibition profiles. These parameters can be compared between standard conditions and stress conditions to understand how YjcC activity is modulated by environmental factors.

How does oxidative stress affect YjcC function and c-di-GMP levels?

Oxidative stress significantly impacts YjcC activity and consequently influences bacterial c-di-GMP signaling:

ConditionEffect on YjcCEffect on c-di-GMPExperimental Evidence
Basal conditionsStandard PDE activityHomeostatic regulationModerate difference between WT and ΔyjcC
Paraquat exposure (30 μM)Enhanced PDE activitySignificant reductionPronounced difference between WT and ΔyjcC
SoxRS activationIncreased YjcC expressionDecreased levelsTranscriptional analysis

Research has demonstrated that exposure to the oxidative stress inducer paraquat (30 μM) results in a more pronounced difference in c-di-GMP levels between wild-type and yjcC deletion strains compared to standard growth conditions . This suggests that YjcC activity is enhanced under oxidative stress, potentially through post-translational modifications or conformational changes that increase its catalytic efficiency.

The regulation of YjcC expression by the SoxRS system provides a mechanism linking oxidative stress sensing to c-di-GMP signaling. The SoxRS regulon is activated by superoxide stress and controls the expression of numerous genes involved in oxidative stress defense. By regulating YjcC expression, this system can modulate c-di-GMP levels in response to changing redox conditions .

Methodologically, researchers can investigate this relationship by:

  • Exposing bacterial cultures to varying concentrations of oxidative stress inducers

  • Measuring changes in yjcC transcription using qRT-PCR

  • Quantifying intracellular c-di-GMP levels using LC-MS

  • Analyzing post-translational modifications of YjcC using mass spectrometry

  • Performing site-directed mutagenesis to identify redox-sensitive residues

What are the implications of YjcC in bacterial stress response mechanisms?

YjcC's role in stress response extends beyond oxidative stress adaptation and involves multiple cellular processes:

Stress ResponseYjcC InvolvementDownstream Effects
Oxidative stressEnhanced PDE activityReduced c-di-GMP, phenotypic adaptation
Stationary phaseRpoS-dependent expressionSurvival and persistence
Anaerobic conditionsPotential FNR regulationMetabolic adaptation
Virulence regulationModulation of signalingHost interaction, pathogenesis

The integration of YjcC into the SoxRS and RpoS regulons positions it as a key component of bacterial general stress responses. The SoxRS system specifically responds to superoxide stress, while RpoS controls gene expression during stationary phase and under various stress conditions . By modulating c-di-GMP levels in response to these signals, YjcC contributes to phenotypic adaptations that enhance bacterial survival.

The potential regulation of YjcC by FNR suggests a role in oxygen sensing and adaptation to anaerobic conditions. This regulatory connection implies that YjcC may help coordinate c-di-GMP signaling with metabolic shifts that occur during transitions between aerobic and anaerobic growth .

Research methodologies to investigate these implications include:

  • Phenotypic characterization of yjcC mutants under various stress conditions

  • Transcriptomic and proteomic analysis of wild-type vs. ΔyjcC strains

  • Epistasis studies with other stress response regulators

  • Host-pathogen interaction studies to assess virulence phenotypes

How can structural studies of YjcC inform its function?

Structural characterization of YjcC provides critical insights into its mechanism of action and regulation:

While complete structural data for YjcC is not yet available, structural studies of related EAL domain-containing proteins can inform our understanding of YjcC function. The EAL domain typically forms a TIM-barrel fold with the active site located at the C-terminal end of the barrel, containing conserved residues for metal coordination and substrate binding.

Comparing the structural features of YjcC with other characterized phosphodiesterases can identify:

  • Conserved catalytic residues essential for activity

  • Potential regulatory sites that respond to oxidative stress

  • Interfaces for protein-protein interactions

  • Conformational changes associated with activation/inhibition

Researchers can use homology modeling based on related structures to predict YjcC structure and function. Site-directed mutagenesis of predicted catalytic and regulatory residues, followed by activity assays, can validate these structural predictions and identify key functional elements.

What are the optimal conditions for recombinant expression of YjcC?

Successful expression and purification of YjcC requires optimization of various parameters:

Expression ParameterOptimization StrategyConsiderations
Expression systemE. coli BL21(DE3) or derivativesMembrane protein expression challenges
VectorpET series with appropriate tagsN-terminal 10xHis tag effective
Induction conditionsTemperature, IPTG concentrationLower temperatures (16-20°C) often better for membrane proteins
SolubilizationDetergent screeningMild detergents preferred (DDM, LMNG)
Purification bufferspH, salt, additivesStabilizing agents (glycerol, specific lipids)

Recombinant expression of membrane proteins like YjcC presents several challenges, including proper folding, membrane insertion, and potential toxicity. Strategies to overcome these challenges include:

  • Using specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Employing fusion partners that enhance solubility (MBP, SUMO)

  • Optimizing induction conditions (reduced temperature, lower inducer concentration)

  • Testing various detergents for efficient solubilization

  • Including stabilizing agents in purification buffers

For YjcC, successful expression has been achieved using an N-terminal 10xHis-tagged construct expressed in an E. coli expression system . The purified protein can be provided in liquid form or as a lyophilized powder, with the latter typically offering greater stability during storage.

Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been effective, with recommended storage at -20°C/-80°C for optimal stability . Aliquoting is necessary to avoid repeated freeze-thaw cycles that can compromise protein integrity.

What assays can be used to measure YjcC phosphodiesterase activity?

Multiple assays are available for quantifying YjcC phosphodiesterase activity:

AssayPrincipleReadoutSensitivity
pNpp hydrolysisCleavage of colorimetric substrateAbsorbance (405 nm)Moderate
HPLC-basedDirect detection of c-di-GMP and pGpGUV absorbance or MSHigh
Fluorescence-basedFRET-labeled c-di-GMP analogsFluorescence changeHigh
Coupled enzymeLink PDE activity to detectable reactionVarious (NADH, ATP)Variable

The pNpp (para-nitrophenyl phosphate) hydrolysis assay has been successfully employed to characterize YjcC EAL domain activity . This assay measures the release of p-nitrophenol (yellow color) upon phosphodiester bond hydrolysis, allowing for spectrophotometric quantification of activity. While this assay is relatively simple and amenable to high-throughput applications, it uses an artificial substrate rather than the natural c-di-GMP substrate.

For more physiologically relevant assessment, HPLC or LC-MS-based assays directly measure the conversion of c-di-GMP to pGpG. A typical protocol involves:

  • Incubation of purified YjcC with c-di-GMP substrate

  • Reaction quenching at defined time points

  • Sample processing for HPLC or LC-MS analysis

  • Quantification of substrate depletion and product formation

  • Derivation of kinetic parameters from time-course data

Control reactions should include heat-inactivated enzyme, catalytically inactive mutants (e.g., substitution in the EAL motif), and reactions without enzyme to account for spontaneous hydrolysis. Positive controls using well-characterized PDEs (e.g., MrkJ) are also valuable for assay validation .

How can researchers create and validate YjcC mutants for functional studies?

Creating and validating YjcC mutants is essential for structure-function analysis:

Mutation TypePurposeValidation Approach
Catalytic siteAssess enzymatic mechanismActivity assays, structural analysis
Domain deletionIdentify domain functionsComplementation, localization studies
Regulatory sitesUnderstand activation mechanismsResponse to oxidative stress
Chimeric constructsMap functional regionsDomain swapping with related proteins

Site-directed mutagenesis can target specific residues predicted to be involved in catalysis, regulation, or protein-protein interactions. For YjcC, key targets include:

  • The EAL motif residues essential for catalytic activity

  • Conserved residues involved in metal coordination

  • Potential redox-sensitive residues (cysteines) that might respond to oxidative stress

  • Residues at domain interfaces that could affect communication between sensing and catalytic domains

Validation of mutant function can be performed through multiple approaches:

  • In vitro activity assays using purified recombinant proteins

  • Complementation of yjcC deletion strains followed by phenotypic analysis

  • Measurement of intracellular c-di-GMP levels in strains expressing mutant variants

  • Structural analysis to confirm predicted conformational changes

  • Stress response assays to assess functionality under oxidative stress conditions

A comparative approach similar to that used for the EAL vs. AAL (catalytically inactive) domains can effectively demonstrate the importance of specific residues or domains . This approach involves expressing wild-type and mutant constructs in parallel, followed by activity assays and phenotypic characterization.

What methods can be used to study YjcC protein-protein interactions?

Understanding YjcC's protein interaction network is crucial for elucidating its role in signaling pathways:

MethodApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo interaction screeningPhysiological contextFalse positives/negatives
Co-immunoprecipitationValidation of specific interactionsDetects native complexesAntibody specificity
Pull-down assaysTargeted interaction analysisControlled conditionsNon-physiological conditions
Crosslinking-MSIdentification of interaction interfacesStructural informationTechnical complexity

Bacterial two-hybrid systems can identify potential interaction partners of YjcC in a cellular context. This approach involves fusing YjcC (or domains of interest) to one half of a split reporter protein, with a library of bacterial proteins fused to the complementary half. Interaction between YjcC and a partner protein brings the reporter halves together, generating a detectable signal.

Co-immunoprecipitation using antibodies against YjcC or epitope tags can isolate native protein complexes from bacterial lysates. This approach can validate interactions identified through screening methods and can detect interactions that occur only under specific conditions, such as oxidative stress.

For membrane proteins like YjcC, specialized approaches may be necessary:

  • Detergent-solubilized membrane fractions for co-IP or pull-down assays

  • In vivo crosslinking to capture transient interactions

  • Bimolecular fluorescence complementation to visualize interactions in intact cells

  • Proximity-dependent biotin labeling (BioID) to identify spatial neighbors

Potential interaction partners to investigate include:

  • Other components of the c-di-GMP signaling network (cyclases, effector proteins)

  • Stress response regulators (SoxRS, RpoS)

  • Redox-sensing proteins that might modulate YjcC activity

  • Membrane proteins involved in stress response signaling

How should researchers interpret changes in c-di-GMP levels in relation to YjcC expression?

Interpreting c-di-GMP changes requires consideration of multiple factors:

ScenarioInterpretationExperimental Approach
Increased YjcC → Decreased c-di-GMPDirect enzymatic effectControlled expression, activity assays
Complex c-di-GMP changesNetwork effects, feedback loopsSystems biology, mathematical modeling
Stress-dependent changesActivation of YjcCTime-course analysis, stress conditions
Strain-specific differencesGenetic background effectsCross-strain comparison

The relationship between YjcC expression and c-di-GMP levels is not always straightforward due to the complexity of c-di-GMP signaling networks. Research has shown that deletion of yjcC results in increased c-di-GMP levels, and this difference becomes more pronounced under oxidative stress conditions . This suggests a direct role for YjcC in controlling c-di-GMP pools, particularly during stress responses.

When interpreting c-di-GMP measurements, researchers should consider:

  • The presence of multiple PDEs and cyclases that contribute to c-di-GMP homeostasis

  • Potential feedback mechanisms where c-di-GMP levels affect the expression or activity of enzymes

  • Spatiotemporal aspects of c-di-GMP signaling, including localized pools of the second messenger

  • The influence of growth phase and environmental conditions on baseline c-di-GMP levels

Rigorous experimental design involving time-course measurements, controlled expression systems, and appropriate controls can help distinguish direct effects of YjcC from broader network responses. Complementation experiments using wild-type and catalytically inactive YjcC variants are particularly informative in establishing causality.

What statistical approaches are appropriate for analyzing YjcC enzymatic assay data?

Statistical analysis of enzymatic data requires appropriate methods:

Data TypeStatistical ApproachImplementation
Enzyme kineticsNon-linear regressionMichaelis-Menten, allosteric models
Activity comparisonsANOVA with post-hoc testsMultiple condition comparison
Time-course dataRepeated measures analysisAccounting for time dependency
Dose-responseEC50/IC50 determinationFour-parameter logistic regression

For basic enzyme kinetic analysis, Michaelis-Menten parameters (Km, Vmax) can be determined using non-linear regression of initial velocity versus substrate concentration data. More complex kinetic models may be necessary if YjcC exhibits allosteric regulation or substrate inhibition.

When comparing activity across multiple conditions (e.g., wild-type vs. mutants, or various stress conditions), ANOVA followed by appropriate post-hoc tests (Tukey, Dunnett) provides rigorous statistical comparison. For non-normally distributed data, non-parametric alternatives like Kruskal-Wallis should be considered.

Time-course measurements of c-di-GMP levels require statistical approaches that account for the non-independence of repeated measurements. Mixed-effects models or repeated measures ANOVA can address this complexity and identify significant trends over time.

Researchers should consider:

  • Power analysis to determine appropriate sample sizes

  • Verification of statistical assumptions (normality, homoscedasticity)

  • Appropriate controls for batch effects and experimental variability

  • Correction for multiple comparisons when necessary

  • Reporting of effect sizes alongside p-values for biological interpretation

How can researchers differentiate between direct and indirect effects of YjcC on bacterial phenotypes?

Distinguishing direct from indirect effects requires systematic experimental approaches:

ApproachApplicationStrengthsLimitations
Genetic complementationCausality testingDirect functional evidencePlasmid copy number effects
Point mutantsStructure-function analysisPrecise mechanism testingLabor intensive
Suppressor screensPathway identificationUnbiased discoveryComplex interpretation
Biochemical reconstitutionDirect activity confirmationControlled conditionsSimplified system

To establish direct causality between YjcC and observed phenotypes, complementation experiments with wild-type and mutant variants are essential. If expression of wild-type YjcC restores the phenotype in a deletion mutant, while a catalytically inactive variant does not, this strongly suggests a direct effect mediated by phosphodiesterase activity.

Genetic approaches to distinguish direct from indirect effects include:

  • Epistasis analysis with other components of c-di-GMP signaling pathways

  • Construction of double mutants to identify genetic interactions

  • Suppressor screens to identify genes that can compensate for yjcC deletion

  • Controlled expression systems to establish dose-dependency

Biochemical approaches include:

  • In vitro reconstitution of signaling pathways with purified components

  • Direct measurement of YjcC effects on potential target proteins or processes

  • Time-resolved analyses to establish the sequence of events following YjcC activation

Systems biology approaches can help integrate multiple levels of data to build a comprehensive model of YjcC function within cellular networks. Transcriptomic, proteomic, and metabolomic analyses can reveal the broader impact of YjcC on cellular physiology and help distinguish primary from secondary effects.

What bioinformatics tools are useful for analyzing YjcC homologs across bacterial species?

Comparative genomics provides valuable insights into YjcC evolution and function:

Bioinformatics ApproachApplicationTools
Sequence alignmentConservation analysisMUSCLE, Clustal Omega, MAFFT
Phylogenetic analysisEvolutionary relationshipsMEGA, RAxML, MrBayes
Domain architectureStructural organizationPFAM, SMART, InterPro
Genomic contextFunctional associationsSTRING, MicrobesOnline

Sequence alignment of YjcC homologs across bacterial species can identify:

  • Conserved catalytic residues essential for PDE activity

  • Variable regions that may confer species-specific functions

  • Patterns of coevolution between residues that suggest functional interactions

  • Lineage-specific adaptations in response to different ecological niches

Analysis of genomic context provides clues about functional associations:

  • Conservation of gene neighborhoods across species

  • Co-occurrence with other c-di-GMP signaling components

  • Association with specific stress response systems

  • Presence in pathogenicity islands or other specialized genetic elements

Structural bioinformatics approaches can predict:

  • Protein folding and domain organization

  • Potential ligand binding sites

  • Conformational changes associated with activation

  • Protein-protein interaction interfaces

These analyses can guide experimental approaches by identifying conserved features likely to be functionally important and variable regions that might confer specific regulatory properties to YjcC in different bacterial species.

What are common challenges in purifying recombinant YjcC protein?

Membrane protein purification presents several technical challenges:

ChallengeSolution StrategyMonitoring Method
Low expressionOptimization of induction conditionsSDS-PAGE, Western blot
Improper foldingChaperone co-expressionActivity assays, CD spectroscopy
AggregationDetergent screening, stabilizing additivesSize exclusion chromatography
Proteolytic degradationProtease inhibitors, reduced temperatureSDS-PAGE, mass spectrometry

As a membrane protein, YjcC presents specific purification challenges that require careful optimization. The most critical aspects include:

  • Expression level optimization

    • Testing different E. coli strains (BL21, C41/C43, Rosetta)

    • Varying induction conditions (temperature, IPTG concentration, duration)

    • Using specialized expression vectors with tunable promoters

  • Membrane extraction and solubilization

    • Screening multiple detergents for efficient extraction

    • Testing detergent:protein ratios to maximize solubilization

    • Including stabilizing agents (glycerol, specific lipids)

  • Purification optimization

    • Multi-step purification strategy (affinity, ion exchange, size exclusion)

    • Buffer optimization to maintain protein stability

    • Quality control at each purification step

The successful purification of YjcC has been achieved using N-terminal His-tagging, which facilitates affinity purification using immobilized metal affinity chromatography (IMAC) . The purified protein can be stored as a liquid or lyophilized powder, with trehalose addition (6%) improving stability during storage and freeze-thaw cycles .

How can researchers address issues with YjcC solubility and stability?

Optimizing YjcC solubility and stability requires systematic approaches:

FactorOptimization ApproachAssessment Method
Buffer compositionpH, salt, additives screeningThermal shift assay, activity retention
Detergent selectionMicelle size, charge, stabilityProtein yield, monodispersity
Stabilizing agentsGlycerol, arginine, trehaloseLong-term activity, aggregation resistance
Storage conditionsTemperature, concentration, formulationTime-course activity measurements

Buffer optimization strategies include:

  • pH screening to identify optimal hydrogen ion concentration

  • Salt type and concentration variation to optimize electrostatic interactions

  • Addition of stabilizing agents (glycerol, trehalose, arginine)

  • Inclusion of specific lipids that might be required for structural integrity

For the storage of purified YjcC, a Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been found effective . The protein can be stored as a liquid at -20°C/-80°C or lyophilized for longer stability, with the lyophilized form typically maintaining activity for up to 12 months at -20°C/-80°C compared to 6 months for the liquid form .

For activity studies, additional considerations include:

  • Metal ion requirements for catalytic activity (typically Mg2+ or Mn2+)

  • Reducing agents to maintain the redox state of sensitive residues

  • Stabilizing additives that don't interfere with enzymatic assays

  • Proper controls to account for buffer-dependent effects

What controls are essential for YjcC functional assays?

Rigorous controls are critical for reliable functional characterization:

Control TypePurposeImplementation
Negative controlsBackground activity assessmentHeat-inactivated enzyme, buffer-only
Positive controlsAssay validationKnown PDE enzymes (e.g., MrkJ)
Catalytic mutantsMechanism confirmationEAL → AAL mutation
System controlsPhysiological relevanceComplementation experiments

For in vitro enzymatic assays, essential controls include:

  • No-enzyme controls to account for spontaneous substrate hydrolysis

  • Heat-inactivated enzyme controls to distinguish enzymatic from non-enzymatic activity

  • Catalytically inactive mutants (e.g., substitution in the EAL motif)

  • Positive controls using well-characterized phosphodiesterases

For complementation experiments, important controls include:

  • Empty vector controls to account for plasmid-related effects

  • Wild-type complementation to demonstrate full functional restoration

  • Catalytically inactive complementation to distinguish activity-dependent and -independent functions

  • Dose-dependent expression to establish relationships between protein levels and phenotypes

For oxidative stress response studies, appropriate controls include:

  • Non-stressed controls to establish baseline activity

  • Dose-response curves for stress inducers

  • Time-course experiments to capture dynamic responses

  • Genetic controls (e.g., soxRS mutants) to validate stress response pathways

How can researchers overcome challenges in studying membrane-associated proteins like YjcC?

Membrane protein research requires specialized approaches:

ChallengeSolution StrategyTechnological Approach
Structural analysisDetergent micelles, nanodiscsCryo-EM, NMR, X-ray crystallography
Localization studiesFluorescent protein fusionsSuper-resolution microscopy
Interaction mappingCrosslinking, proximity labelingMass spectrometry, proteomics
Functional reconstitutionProteoliposomes, supported bilayersActivity assays, biophysical methods

For structural studies of membrane proteins like YjcC, researchers can employ:

  • Detergent screening to identify conditions that maintain native structure

  • Lipid nanodiscs or amphipols to provide a more native-like environment

  • Crystallization trials using lipidic cubic phase or bicelle methodologies

  • Cryo-EM analysis to visualize the protein in detergent micelles or nanodiscs

For cellular localization and dynamics:

  • Fluorescent protein fusions carefully designed to minimize functional interference

  • Immunofluorescence using antibodies against YjcC or epitope tags

  • Super-resolution microscopy to resolve membrane distribution patterns

  • Single-molecule tracking to monitor dynamic behavior in living cells

For functional studies in membrane context:

  • Reconstitution in proteoliposomes with defined lipid composition

  • Supported lipid bilayers for accessibility to both membrane faces

  • Lipid composition variation to assess lipid-dependent activity

  • Co-reconstitution with interaction partners to study functional coupling

These specialized approaches can provide insights into YjcC function in its native membrane environment, revealing aspects of regulation and activity that might be missed in solubilized preparations.

What are emerging areas of research related to YjcC and c-di-GMP signaling?

Several promising research directions are expanding our understanding of YjcC:

Research AreaPotential ImpactMethodological Approaches
Spatiotemporal dynamicsLocalized signaling mechanismsAdvanced microscopy, optogenetics
Integration with other signaling pathwaysNetwork-level understandingMulti-omics, systems biology
Structural dynamicsActivation mechanismsHDX-MS, FRET sensors, molecular dynamics
Single-cell heterogeneityPopulation-level adaptationSingle-cell analysis, microfluidics

Emerging research areas include:

  • Spatiotemporal dynamics of c-di-GMP signaling

    • Development of fluorescent sensors for c-di-GMP visualization in live cells

    • Investigation of membrane microdomains as signaling platforms

    • Optogenetic control of YjcC activity to study localized signaling

  • Cross-talk with other signaling pathways

    • Integration of c-di-GMP signaling with other bacterial second messengers

    • Connections between oxidative stress response and antibiotic tolerance

    • Interactions between YjcC and quorum sensing networks

  • Single-cell analysis of YjcC function

    • Heterogeneity in YjcC expression and activity within bacterial populations

    • Bet-hedging strategies involving c-di-GMP signaling

    • Differential responses to environmental stressors at the single-cell level

  • Evolutionary aspects of YjcC function

    • Comparative analysis across bacterial species

    • Identification of selective pressures shaping YjcC function

    • Host-pathogen co-evolution involving c-di-GMP signaling systems

How might YjcC be involved in bacterial pathogenesis and virulence?

YjcC's role in pathogenesis connects to multiple virulence mechanisms:

Virulence AspectYjcC InvolvementExperimental Approach
Biofilm formationc-di-GMP regulationBiofilm assays, infection models
Stress adaptation during infectionOxidative stress responseHost cell co-culture, ROS detection
Host immune evasionPhenotypic plasticityImmune cell interaction studies
Antibiotic tolerancePersister cell formationMinimal inhibitory concentration testing

The connection between YjcC and virulence stems from:

  • Regulation of biofilm formation

    • c-di-GMP controls the transition between planktonic and biofilm lifestyles

    • Biofilms contribute to persistence in host environments and antibiotic tolerance

    • YjcC-mediated modulation of c-di-GMP could affect biofilm development

  • Adaptation to host-derived stress

    • Host immune cells generate oxidative stress during infection

    • YjcC's enhanced activity under oxidative stress could aid bacterial adaptation

    • Connections to SoxRS and RpoS link YjcC to broader stress responses

  • Virulence gene regulation

    • c-di-GMP signaling affects virulence gene expression in many pathogens

    • YjcC could indirectly modulate virulence through c-di-GMP-dependent pathways

    • Integration with other signaling systems could coordinate virulence programs

Research approaches include:

  • Comparison of wild-type and yjcC mutant strains in infection models

  • Analysis of virulence gene expression in response to YjcC modulation

  • Assessment of survival under host-relevant stress conditions

  • Evaluation of antibiotic tolerance and persistence mechanisms

What therapeutic potential exists in targeting YjcC or related phosphodiesterases?

Inhibiting bacterial PDEs offers promising therapeutic strategies:

Therapeutic ApproachPotential AdvantageDevelopment Challenges
PDE inhibitorsBiofilm disruptionSelectivity, delivery
Combination therapyEnhanced antibiotic efficacyDrug interaction complexity
Anti-virulence strategyReduced selection pressureEfficacy measurement
Adjuvant therapyHost defense enhancementSafety profile

The therapeutic potential of targeting YjcC or related phosphodiesterases stems from:

  • Biofilm disruption

    • Inhibiting PDEs increases c-di-GMP levels, potentially disrupting the balance required for biofilm integrity

    • Combining PDE inhibitors with antibiotics could enhance efficacy against biofilm-associated infections

  • Virulence attenuation

    • Modulating c-di-GMP signaling could interfere with virulence gene expression

    • Anti-virulence approaches may reduce selection pressure for resistance

  • Stress response interference

    • Targeting YjcC could compromise bacterial adaptation to host-derived stresses

    • Combination with immune-enhancing therapies could create synergistic effects

Drug development considerations include:

  • High-throughput screening for selective YjcC inhibitors

  • Structure-based design using resolved or modeled protein structures

  • Phenotypic screening for compounds that affect c-di-GMP-dependent behaviors

  • Development of appropriate animal models to evaluate efficacy

Challenges include achieving selectivity for bacterial over mammalian PDEs, developing compounds with appropriate pharmacokinetic properties, and designing clinical trials that can effectively evaluate anti-virulence strategies.

How can systems biology approaches advance our understanding of YjcC in cellular networks?

Systems approaches provide holistic insights into YjcC function:

Systems ApproachInformation GainedMethodological Implementation
Network modelingSignaling pathway integrationDifferential equations, Bayesian networks
Multi-omics integrationGlobal cellular impactTranscriptomics, proteomics, metabolomics
Perturbation biologyNetwork robustnessCRISPR screening, chemical genetics
In silico predictionEmergent propertiesMachine learning, constraint-based modeling

Systems biology approaches to study YjcC include:

  • Multi-omics integration

    • Transcriptomic analysis of yjcC mutants under various conditions

    • Proteomic identification of differentially expressed proteins

    • Metabolomic profiling to assess broader metabolic impacts

    • Integration of datasets to build comprehensive models

  • Network modeling

    • Mathematical modeling of c-di-GMP signaling dynamics

    • Incorporation of YjcC regulation and activity into existing models

    • Simulation of cellular responses to environmental perturbations

    • Prediction of emergent behaviors from network interactions

  • Genome-scale approaches

    • Transposon sequencing to identify genetic interactions with yjcC

    • CRISPR interference screens to map functional connections

    • Global protein-protein interaction mapping

    • Synthetic genetic array analysis

These approaches can reveal:

  • Non-intuitive connections between YjcC and other cellular processes

  • Emergent properties arising from network-level interactions

  • Feedback and feedforward loops involving YjcC

  • Potential compensatory mechanisms that maintain c-di-GMP homeostasis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.