Recombinant Escherichia coli Uncharacterized membrane protein YuaD (yuaD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yuaD; ybcA; ECOK12F013; Uncharacterized membrane protein YuaD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yuaD
Target Protein Sequence
MRAYCPHYQFMLFWIASLCWFSLIVLWGTGFYSLLFYIISVLLIIILYTLYFIGENMFSK GKIKESDSTTTIISKNTSFVGDISSGEKIIIHGKINGNINTNNGVVFIDKGGVVNGRVLC EKMILNGELYGECCCSTLDVYENGFLQGEVSYRFLEIRNGGCITGIVNKVTDEVQNNVSE LVKARES
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YuaD protein and what are its fundamental characteristics?

YuaD is an uncharacterized membrane protein in Escherichia coli consisting of 187 amino acids with the UniProt ID Q9JMT6. The complete amino acid sequence is: MRAYCPHYQFMLFWIASLCWFSLIVLWGTGFYSLLFYIISVLLIIILYTLYFIGENMFSKGKIKESDSTTTIISKNTSFVGDISSGEKIIIHGKINGNINTNNGVVFIDKGGVVNGRVLCEKMILNGELYGECCCSTLDVYENGFLQGEVSYRFLEIRNGGCITGIVNKVTDEVQNNVSELVKARES . Analysis of this sequence reveals a hydrophobic N-terminal region (approximately residues 1-60) that likely constitutes transmembrane domains, followed by more hydrophilic regions that may form extracellular or cytoplasmic domains. The protein contains multiple cysteine residues that potentially form disulfide bonds important for structural stability. YuaD shares some sequence similarity with other uncharacterized membrane proteins across bacterial species, suggesting conserved functions that remain to be elucidated through comparative genomics and proteomic approaches .

What expression systems are most effective for producing recombinant YuaD protein?

E. coli expression systems have proven most effective for producing recombinant YuaD protein. Specifically, homologous expression (expressing the E. coli protein in E. coli) offers advantages for membrane protein production by providing the native folding environment. The established protocol utilizes an N-terminal His-tag fusion strategy in E. coli expression systems, allowing for effective purification via metal affinity chromatography . Alternative expression systems including cell-free expression systems may be considered when protein aggregation or toxicity issues are encountered, though these typically yield lower amounts of protein. Induction conditions should be optimized with lower temperatures (16-20°C) and reduced inducer concentrations to enhance proper folding of membrane proteins. Protein expression validation should be performed through Western blotting with anti-His antibodies before scaling up production.

How should recombinant YuaD protein be stored and reconstituted for maximum stability and activity?

Recombinant YuaD protein requires specific storage and reconstitution protocols to maintain structural integrity. The lyophilized protein should be stored at -20°C/-80°C upon receipt, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that can lead to protein denaturation . For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (with 50% as the default final concentration) is strongly recommended before aliquoting for long-term storage at -20°C/-80°C to prevent freeze-thaw damage . Reconstituted YuaD should be briefly centrifuged before opening to ensure all contents are at the bottom of the vial. For membrane protein function studies, additional reconstitution into lipid bilayers or detergent micelles may be necessary to maintain native conformation and activity, using detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration.

What purification methods yield the highest purity of recombinant YuaD protein?

Multi-step purification strategies yield the highest purity for recombinant YuaD protein. Initial purification utilizes immobilized metal affinity chromatography (IMAC) targeting the N-terminal His-tag, typically using Ni-NTA or Co-NTA resins . This should be followed by size exclusion chromatography (SEC) to separate protein aggregates and achieve purity levels greater than 90% as determined by SDS-PAGE . Throughout purification, maintaining the protein in appropriate buffer conditions (Tris/PBS-based buffer, pH 8.0 with 6% Trehalose) is critical for stability . For enhanced purity required in structural studies, additional ion exchange chromatography may be employed, with buffers containing appropriate detergent concentrations to maintain the solubility of this membrane protein. Purification should be performed at 4°C to minimize protein degradation, and protease inhibitors should be included in all buffers to prevent proteolytic cleavage.

What experimental approaches can be used to investigate YuaD function in bacterial membrane biology?

Investigating YuaD function requires a multi-faceted experimental approach combining genetics, proteomics, and structural biology. Gene knockout studies using CRISPR-Cas9 or traditional homologous recombination methods can reveal phenotypic changes associated with YuaD absence, particularly under different environmental stresses . Complementation with ΔyadC strains (as performed with other E. coli membrane proteins) can provide validation of functional studies . Protein-protein interaction studies using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking mass spectrometry can identify binding partners of YuaD . Structural characterization through X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance can provide insights into functional domains. Comparative analysis with other bacterial membrane proteins may reveal conserved functional motifs.

The following experimental design table outlines a systematic approach to YuaD functional characterization:

Experimental ApproachMethodologyExpected OutcomesConsiderations
Gene knockoutCRISPR-Cas9 gene editingPhenotypic changes in growth, stress response, or membrane integrityRequires optimization of guide RNAs and transformation efficiency
Localization studiesFluorescent protein fusion or immunofluorescenceSubcellular localization patternTag position may affect protein function
Protein-protein interactionsCo-immunoprecipitation, mass spectrometryIdentification of interacting partnersMembrane protein interactions require special detergent conditions
Structural analysisCryo-EM or X-ray crystallography3D structure elucidationRequires high purity and stability of the protein sample
Transcriptional regulationRNA-Seq, qPCRExpression patterns under different conditionsBiological replicates essential for statistical significance

How can researchers validate the structural integrity of recombinant YuaD after purification?

Validating structural integrity of recombinant YuaD requires a combination of biophysical and biochemical techniques. Circular dichroism (CD) spectroscopy can assess secondary structure composition, with particular attention to alpha-helical content expected in membrane proteins. Thermal shift assays (differential scanning fluorimetry) can determine protein stability under different buffer conditions. Tryptophan fluorescence spectroscopy can reveal information about tertiary structure integrity. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can confirm protein monodispersity and quaternary structure . For membrane proteins like YuaD, reconstitution into lipid nanodiscs or proteoliposomes followed by negative-stain electron microscopy can provide visual confirmation of proper folding. Functional assays (if known) provide the ultimate validation of correct structure. Activity measurements may include ligand binding assays using isothermal titration calorimetry or surface plasmon resonance if binding partners are identified.

What are the challenges and solutions in crystallizing membrane proteins like YuaD for structural studies?

Membrane proteins like YuaD present significant crystallization challenges due to their hydrophobicity, conformational flexibility, and requirement for detergents or lipid environments. The primary obstacles include obtaining sufficient quantities of properly folded protein, identifying suitable detergent/lipid conditions, and achieving crystal contacts in the presence of micelles. Successful crystallization strategies include lipidic cubic phase (LCP) crystallization, which provides a more native-like lipid environment compared to traditional vapor diffusion methods. Fusion protein approaches, such as T4 lysozyme or BRIL insertion into flexible loops, can promote crystal contacts and stabilize specific conformations . Antibody fragment (Fab or nanobody) co-crystallization can provide additional hydrophilic surfaces for crystal contacts. Surface entropy reduction through site-directed mutagenesis of surface residues with high conformational entropy (lysine, glutamate, and glutamine) to alanine can enhance crystallizability. Screening should encompass a wide range of conditions, including different detergents, lipids, precipitants, pH values, and temperatures, often requiring automated high-throughput approaches.

What factorial experimental designs are most appropriate for optimizing YuaD expression conditions?

Factorial experimental designs offer efficient approaches for optimizing multiple variables affecting YuaD expression simultaneously. Two-level factorial designs allow researchers to test the effects of multiple factors at two levels (high and low) and assess their interactions . For YuaD expression optimization, a typical 2^4 factorial design would include: temperature (16°C vs. 37°C), inducer concentration (0.1 mM vs. 1 mM IPTG), expression time (4 hours vs. overnight), and media composition (LB vs. enriched media). Analysis of main effects and interactions identifies the most significant parameters affecting protein yield and solubility. When uniform conditions cannot be maintained throughout large experiments, blocked factorial designs can control for day-to-day or batch-to-batch variation . Fractional factorial designs (such as 2^(k-p) designs) reduce the number of experimental runs while still capturing main effects and low-order interactions, particularly useful in initial screening phases .

The following table illustrates a 2^3 factorial design for optimization of YuaD expression:

RunTemperature (°C)IPTG (mM)Expression Time (h)Expected Response Variables
116 (-)0.1 (-)4 (-)Protein yield, solubility, activity
237 (+)0.1 (-)4 (-)Protein yield, solubility, activity
316 (-)1.0 (+)4 (-)Protein yield, solubility, activity
437 (+)1.0 (+)4 (-)Protein yield, solubility, activity
516 (-)0.1 (-)18 (+)Protein yield, solubility, activity
637 (+)0.1 (-)18 (+)Protein yield, solubility, activity
716 (-)1.0 (+)18 (+)Protein yield, solubility, activity
837 (+)1.0 (+)18 (+)Protein yield, solubility, activity

What detergent screening approaches should be employed for solubilizing and purifying YuaD?

Systematic detergent screening is essential for successful solubilization and purification of membrane proteins like YuaD. Initial screening should include detergents from different classes: maltoside detergents (DDM, UDM, DM), glucoside detergents (OG), neopentyl glycols (LMNG), zwitterionic detergents (LDAO, FC-12), and non-ionic detergents (Triton X-100, C12E8). Small-scale extractions (1-5 mg membrane) should be performed with each detergent at concentrations 2-5× above their critical micelle concentration (CMC), followed by ultracentrifugation and analysis of supernatant by Western blotting and functional assays. Secondary screening should optimize promising detergents by testing different concentrations and extraction conditions (time, temperature, salt concentration). For stabilization during purification, detergent mixtures or addition of lipids (cholesteryl hemisuccinate or specific phospholipids) can be employed. Assessment of protein monodispersity through analytical size exclusion chromatography or dynamic light scattering provides crucial information on detergent suitability. Modern approaches also include testing alternative solubilization systems such as styrene-maleic acid lipid particles (SMALPs), amphipols, or nanodiscs for downstream applications requiring a more native-like environment.

How can isotope labeling be incorporated into YuaD expression for NMR structural studies?

Isotope labeling for NMR studies of YuaD requires specialized expression protocols to achieve sufficient incorporation of NMR-active nuclei (^15N, ^13C, ^2H). Uniform ^15N labeling can be achieved using minimal media with ^15NH4Cl as the sole nitrogen source, while ^13C labeling requires ^13C-glucose as the carbon source. Expression in deuterated media (D2O) with deuterated carbon sources enables perdeuteration, crucial for reducing spectral complexity of large membrane proteins. An efficient protocol involves a stepwise adaptation of E. coli cultures to increasing D2O concentrations (50%, 75%, 99.9%) before final expression. Selective isotope labeling of specific amino acid types (such as methionine, tryptophan, or phenylalanine) can be accomplished using auxotrophic E. coli strains or by metabolic precursor incorporation. For membrane proteins like YuaD, expression yields in minimal media are typically lower than in rich media, necessitating optimization of growth temperature, inducer concentration, and expression duration. Purification should be performed with detergents that maintain protein stability while minimizing spectral interference. The final NMR sample should contain 0.3-1.0 mM protein in deuterated detergents to reduce background signals, with appropriate buffer conditions optimized for long-term stability during extended NMR experiments.

What computational approaches can predict the structure and function of YuaD based on its amino acid sequence?

Computational prediction of YuaD structure and function employs a multi-layered approach combining sequence analysis, homology modeling, and molecular dynamics simulations. Initial sequence analysis using transmembrane prediction algorithms (TMHMM, Phobius, MEMSAT) identifies potential membrane-spanning regions within YuaD's 187-amino acid sequence . Secondary structure prediction tools (PSIPRED, JPred) estimate the distribution of alpha-helices and beta-strands. For remote homology detection, tools like HHpred and FFAS search for structural templates with similar fold despite low sequence identity. Homology modeling can then be performed using Rosetta Membrane, MODELLER, or AlphaFold2, with special consideration for membrane protein-specific energy functions. Molecular dynamics simulations in explicit lipid bilayers can refine models and assess stability, using GROMACS or NAMD with specialized force fields for membrane environments. Functional prediction utilizes tools like InterProScan to identify conserved domains, ConSurf for evolutionary conservation analysis, and molecular docking to predict potential ligand binding sites. Integration of results from multiple prediction methods provides the most reliable structural and functional hypotheses for subsequent experimental validation.

How can researchers address poor solubility and aggregation of recombinant YuaD during expression and purification?

Poor solubility and aggregation of recombinant YuaD can be addressed through systematic optimization of expression and purification conditions. Expression temperature reduction to 16-20°C significantly decreases aggregation by slowing protein synthesis and allowing proper folding, particularly important for membrane proteins. Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE, or Trigger Factor) can enhance proper folding. Fusion tags beyond the standard His-tag, such as MBP (maltose-binding protein) or SUMO, can dramatically increase solubility. For purification, screening multiple detergents is critical, with mild non-ionic detergents like DDM or LMNG often providing better solubilization while preserving native structure. Addition of stabilizing agents (glycerol, specific lipids, or trehalose) to all buffers helps maintain protein stability . Protein aggregation can be monitored using dynamic light scattering or analytical ultracentrifugation. For severe aggregation cases, extraction from inclusion bodies using mild solubilization agents (N-lauroylsarcosine, SDS) followed by refolding through dialysis against decreasing detergent concentrations may be necessary. Protein engineering approaches, including surface residue mutations to increase hydrophilicity or removal of flexible regions prone to aggregation, represent more advanced solutions.

What strategies can overcome contamination issues during YuaD purification?

Contamination during YuaD purification can be addressed through multiple strategic approaches targeting specific contaminant types. For non-specific binding to affinity resins, optimization of imidazole concentrations in wash buffers (typically 20-50 mM) prevents weakly-bound contaminants while retaining His-tagged YuaD. Addition of low concentrations of non-ionic detergents (0.1% Triton X-100) to wash buffers reduces hydrophobic interactions between contaminants and resins. Higher salt concentrations (300-500 mM NaCl) in wash buffers disrupt ionic interactions. For persistent contaminants with similar properties to YuaD, a dual-tagging approach using orthogonal purification methods (His-tag followed by another affinity tag) significantly enhances purity. On-column refolding during affinity chromatography using decreasing concentrations of mild denaturants can separate properly folded YuaD from misfolded proteins and aggregates. Size exclusion chromatography as a final polishing step effectively separates contaminants of different molecular weights. For contaminants with different isoelectric points, ion exchange chromatography provides additional separation power. Systematic optimization of each purification step through small-scale screening followed by scaled-up purification ensures reproducible high-purity YuaD preparations.

How can researchers validate YuaD function in the absence of known activity assays?

Validating YuaD function without known activity assays requires an integrated approach combining genomic context analysis, phenotypic studies, and comparative biology. Genomic neighborhood analysis examines genes co-located with yuaD to identify functionally related proteins or operons that might suggest shared pathways. Gene knockout or knockdown studies using CRISPR-Cas9 or RNA interference can reveal phenotypic changes in growth, stress response, membrane integrity, or antibiotic susceptibility . Complementation assays with wild-type yuaD gene can confirm phenotype specificity. Comparative expression profiling using RNA-Seq under different environmental conditions identifies conditions that induce yuaD expression, suggesting functional contexts. Protein-protein interaction studies using pull-down assays followed by mass spectrometry analysis can identify binding partners that hint at biological function . Heterologous expression in other bacterial systems followed by phenotypic analysis might reveal gain-of-function phenotypes. Structural classification through computational methods or experimental structure determination can place YuaD in known structural families with established functions. Evolutionary analysis across bacterial species can identify conserved regions suggestive of functional importance.

What controls and validation steps are essential in YuaD localization studies?

Robust controls and validation steps are critical for accurate YuaD localization studies. When using fluorescent protein fusions, controls should include both N-terminal and C-terminal tags to account for potential interference with localization signals. Functional complementation assays must verify that fusion proteins retain native function. Fixed-cell microscopy should be validated with live-cell imaging to exclude fixation artifacts. Immunofluorescence requires validation of antibody specificity through Western blotting against wild-type, knockout, and overexpression samples. Multiple antibodies targeting different epitopes should ideally show consistent localization patterns. Subcellular fractionation followed by Western blotting provides biochemical validation of microscopy results. Co-localization with established membrane markers (inner membrane, outer membrane) confirms specific membrane association. Super-resolution microscopy techniques (STORM, PALM) can resolve nanoscale distribution patterns obscured in conventional microscopy. For quantitative analysis, automated image analysis algorithms should be validated against manual counting in representative images. Statistical analysis should include sufficient biological replicates (minimum n=3) and technical replicates to ensure reproducibility.

How might YuaD be involved in antimicrobial resistance mechanisms in E. coli?

YuaD's potential role in antimicrobial resistance warrants investigation, especially considering the rising resistance rates among E. coli isolates causing urinary tract infections . As a membrane protein, YuaD could potentially contribute to resistance through several mechanisms. It might function in membrane permeability regulation, restricting antibiotic entry into bacterial cells. Alternatively, it could participate in efflux pump complexes that actively export antibiotics from the cell. YuaD might also be involved in stress response pathways activated during antibiotic exposure, contributing to adaptive resistance. Comparative studies between susceptible and resistant E. coli strains could reveal differences in YuaD expression levels or sequence variations that correlate with resistance phenotypes. Gene knockout studies followed by minimum inhibitory concentration (MIC) determinations for various antibiotic classes would directly test YuaD's contribution to resistance . Overexpression studies could determine if increased YuaD levels confer increased resistance. Protein-protein interaction studies might identify associations with known resistance determinants. Transcriptional response analysis could reveal whether yuaD expression is regulated by antibiotic exposure or by known resistance regulators.

What role might YuaD play in E. coli pathogenesis, particularly in urinary tract infections?

YuaD may contribute to E. coli pathogenesis in urinary tract infections through several potential mechanisms that warrant investigation. As a membrane protein, YuaD could function in adherence to host tissues, similar to the role of YadC in mediating UPEC adhesion and invasion of bladder epithelial cells . It might participate in biofilm formation, a critical virulence factor in persistent UTIs. YuaD could potentially function in environmental sensing, allowing bacteria to detect and respond to host defense mechanisms or nutrient availability within the urinary tract. It might be involved in stress response pathways critical for bacterial survival in the harsh urinary environment. Investigation approaches should include comparing yuaD presence and sequence variations between uropathogenic and non-pathogenic E. coli strains, similar to phylogenetic analyses performed for yadC . In vitro adhesion and invasion assays using bladder epithelial cells could determine if YuaD knockout affects these virulence properties. Animal models of UTI comparing wild-type and ΔyuaD strains would directly assess contribution to in vivo pathogenesis. Transcriptional profiling during infection could reveal whether yuaD expression is regulated during different stages of pathogenesis.

How can structural studies of YuaD inform the development of novel antimicrobial strategies?

Structural studies of YuaD could significantly inform novel antimicrobial development, particularly if YuaD proves essential for bacterial survival or virulence. High-resolution structures obtained through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would reveal potential ligand-binding pockets or active sites amenable to small molecule targeting. If YuaD functions in membrane integrity or transport, structures in different conformational states could identify mechanisms for disrupting these functions. Molecular dynamics simulations based on experimental structures could identify cryptic binding sites not obvious in static structures. Structure-based virtual screening against resolved YuaD structures could identify lead compounds for further development. Fragment-based drug discovery approaches, combined with biophysical validation (thermal shift assays, surface plasmon resonance), could identify chemical scaffolds with binding affinity to YuaD. If YuaD proves to be part of multi-protein complexes, interface regions could be targeted to disrupt protein-protein interactions critical for function. Targeting membrane proteins like YuaD represents a promising strategy against the rising antimicrobial resistance in E. coli strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.