Recombinant Escherichia coli Uncharacterized oxidoreductase YgjR (ygjR)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant YgjR is derived from the ygjR gene (locus tags: b3087, JW3058) in E. coli K-12. The protein has a molecular weight corresponding to its 328-amino-acid sequence and is tagged with a hexahistidine (His) motif for purification .

Key Features:

PropertyDetails
UniProt IDP42599
Gene NameygjR
Protein LengthFull-length (1–328 aa)
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Production and Purification

Recombinant YgjR is expressed in E. coli BL21(DE3) or similar strains using plasmid vectors with T7/lacUV5 promoters . Key steps include:

  • Cloning: The ygjR coding sequence is inserted into expression vectors (e.g., pET series).

  • Induction: Protein synthesis is induced with IPTG.

  • Purification: Immobilized metal affinity chromatography (IMAC) leverages the His tag .

  • Storage: Lyophilized at -20°C/-80°C; reconstitution in sterile water with 50% glycerol recommended .

Critical Parameters:

ParameterOptimization Strategy
SolubilityUse of oxidative cytoplasm strains (e.g., SHuffle® T7) for disulfide bond formation .
Codon BiasCo-expression with rare tRNA plasmids (e.g., Rosetta™ strains) .
StabilityAvoid repeated freeze-thaw cycles; aliquot working solutions .

Research Applications

  • Enzyme Characterization: Used in preliminary kinetic assays to identify substrate specificity .

  • Structural Biology: Candidates for X-ray crystallography or cryo-EM due to high purity .

  • Metabolic Engineering: Potential inclusion in synthetic pathways for hydrogen production or redox balancing .

Challenges and Limitations

  • Functional Ambiguity: Lack of confirmed substrates or catalytic activity limits mechanistic studies.

  • Stability Issues: Requires strict storage conditions (-80°C) to prevent aggregation .

  • Commercial Variability: Tag placement (His tag) and buffer composition differ across suppliers .

Future Directions

  • Activity Screening: High-throughput assays to identify potential redox partners or inhibitors.

  • Strain Engineering: Use of E. coli SHuffle® or Origami™ strains to improve folding efficiency .

  • Structural Resolution: Cryo-EM studies to elucidate active-site architecture.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (incurring additional fees).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ygjR; b3087; JW3058; Uncharacterized oxidoreductase YgjR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ygjR
Target Protein Sequence
MIRFAVIGTNWITRQFVEAAHESGKYKLTAVYSRSLEQAQHFANDFSVEHLFTSLEAMAE SDAIDAVYIASPNSLHFSQTQLFLSHKINVICEKPLASNLAEVDAAIACARENQVVLFEA FKTACLPNFHLLRQALPKVGKLRKVFFNYCQYSSRYQRYLDGENPNTFNPAFSNGSIMDI GFYCLASAVALFGEPKSVQATASLLASGVDAQGVVVMDYGDFSVTLQHSKVSDSVLASEI QGEAGSLVIEKLSECQKVCFVPRGSQMQDLTQPQHINTMLYEAELFATLVDEHLVDHPGL AVSRITAKLLTEIRRQTGVIFPADSVKL
Uniprot No.

Q&A

What is YgjR and what is its predicted function in Escherichia coli?

YgjR (gene designation ygjR) is an uncharacterized oxidoreductase in Escherichia coli that likely plays a significant role in cellular metabolism. As an oxidoreductase, YgjR catalyzes redox reactions, involving the transfer of electrons between molecules. Similar to other uncharacterized proteins in bacteria (such as YjeQ), YgjR appears to be conserved across bacterial species, suggesting functional importance . The enzyme likely belongs to the broader family of cofactor-dependent oxidoreductases that facilitate essential metabolic processes in bacteria.

Sequence analysis indicates that YgjR contains domains typical of oxidoreductases, with potential binding sites for cofactors such as NAD(P)H or flavins. Like other oxidoreductases described in the literature, YgjR may employ these cofactors to enable its catalytic function in redox chemistry . While its specific physiological substrate remains to be identified, YgjR's classification as an oxidoreductase points to potential roles in energy metabolism, biosynthetic pathways, or oxidative stress response mechanisms in E. coli.

How does YgjR compare structurally to other characterized oxidoreductases in E. coli?

YgjR shares structural features with other oxidoreductases while maintaining unique characteristics that distinguish it within this enzyme class. Based on sequence analysis and structural predictions, YgjR likely contains:

  • A Rossmann fold or similar nucleotide-binding domain for cofactor interaction

  • Conserved catalytic residues typical of oxidoreductases

  • Substrate-binding regions that define its specificity

The table below compares key structural features of YgjR with better-characterized oxidoreductases in E. coli:

FeatureYgjR (predicted)Characterized OxidoreductasesSignificance
Cofactor binding motifsNAD(P)H/flavin bindingSimilar to other oxidoreductasesEssential for electron transfer
Domain organizationMulti-domain structureCommon in oxidoreductase familiesSeparates catalytic and binding functions
Active site architectureContains conserved catalytic residuesVaries based on substrate specificityDetermines reaction mechanism
Quaternary structureLikely homodimeric or tetramericOften oligomericMay influence substrate access and activity regulation

Unlike some circularly permuted GTPases like YjeQ that show rearrangements of conserved sequence motifs (G4-G1-G3 pattern instead of the standard G1-G3-G4) , YgjR appears to maintain the conventional arrangement of oxidoreductase domains, though definitive structural characterization awaits crystallographic studies.

What cofactors are predicted to associate with YgjR activity?

Based on sequence analysis and comparison with characterized oxidoreductases, YgjR likely requires specific cofactors for its catalytic function. While experimental confirmation is necessary, the following cofactors are predicted to be associated with YgjR:

CofactorRole in OxidoreductasesDetection MethodExpected Impact on YgjR Activity
NAD(P)HElectron donorUV-Vis spectroscopy (340 nm)Primary electron source for reduction reactions
FAD/FMNElectron transfer intermediaryFluorescence spectroscopyEssential for catalytic mechanism
Metal ions (Fe, Cu, Zn)Catalytic or structural rolesICP-MS, EPR spectroscopyMay stabilize reaction intermediates
Coenzyme F420Alternative electron carrierSpecialized fluorescence assaysPossible in specific metabolic contexts

Similar to cofactor-dependent oxidoreductases described in recent research, YgjR may utilize these cofactors to facilitate electron transfer in its catalytic cycle . Experimental confirmation would involve spectroscopic analysis of the purified enzyme, activity assays with and without potential cofactors, and structural studies to identify cofactor binding sites. The particular cofactor requirements would provide significant insights into YgjR's physiological role and reaction mechanism.

What expression systems are most effective for producing recombinant YgjR?

Optimizing expression of recombinant YgjR requires careful consideration of expression systems and conditions. Based on experiences with similar oxidoreductases, the following expression strategies are recommended:

  • Bacterial Expression Systems:

    • E. coli BL21(DE3) for standard expression

    • E. coli Rosetta strains for rare codon optimization

    • E. coli SHuffle or Origami strains if disulfide bonds are present

  • Expression Vector Selection:

    • pET vectors with T7 promoter for high-level expression

    • pBAD vectors for tunable arabinose-inducible expression

    • pCold vectors for low-temperature expression to improve solubility

  • Optimization Parameters:

ParameterRange to TestMonitoring MethodExpected Outcome
Induction temperature16-37°CSDS-PAGELower temperatures often improve solubility
IPTG concentration0.1-1.0 mMActivity assaysOptimal concentration balances yield and solubility
Expression duration4-24 hoursTime-course analysisExtended expression may lead to inclusion bodies
Media compositionLB, TB, auto-inductionComparative yield analysisRich media typically increases protein yield
  • Solubility Enhancement Strategies:

    • Fusion partners (MBP, SUMO, TrxA) to improve solubility

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Addition of stabilizing agents (glycerol, low concentrations of detergents)

When expressing proteins similar to YgjR, researchers have found that controlling induction parameters carefully and using E. coli strains optimized for recombinant protein expression significantly improves yield and quality .

How can enzymatic activity of YgjR be reliably measured and characterized?

Establishing reliable assays for YgjR activity is crucial for its functional characterization. A comprehensive approach includes:

  • Spectrophotometric Continuous Assays:

    • NAD(P)H oxidation/reduction monitoring at 340 nm

    • Artificial electron acceptors (DCPIP, ferricyanide) with absorbance changes

    • Oxygen consumption using oxygen electrodes

  • Discontinuous Analytical Methods:

    • HPLC analysis of substrate consumption and product formation

    • Mass spectrometry to identify reaction products

    • Coupled enzyme assays for detecting reaction products

  • Kinetic Parameter Determination Protocol:

    • Measure initial rates at varying substrate concentrations (5-10 concentrations spanning 0.1-10× Km)

    • Plot data using appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Calculate key parameters (Km, Vmax, kcat, kcat/Km)

    • Analyze the effects of pH, temperature, and ionic strength

Similar approaches were used for characterizing the nucleotide hydrolysis activity of YjeQ, where both steady-state and pre-steady state kinetics revealed important functional properties . For YgjR, it would be crucial to design assays that can distinguish between different potential substrates and provide mechanistic insights into its catalytic cycle.

What mutagenesis strategies best illuminate structure-function relationships in YgjR?

Site-directed mutagenesis provides powerful insights into YgjR's catalytic mechanism and substrate specificity. A systematic approach includes:

  • Target Selection Strategy:

    • Conserved residues identified through multiple sequence alignment

    • Predicted cofactor-binding residues from homology models

    • Potential catalytic residues identified through structural prediction

    • Surface residues that may participate in protein-protein interactions

  • Mutation Design Framework:

Residue TypeMutation StrategyExpected OutcomeControl Experiments
Catalytic residuesConservative and non-conservative substitutionsSignificant activity reductionStructural integrity verification
Cofactor bindingAlanine substitutionsAltered cofactor affinityCofactor binding assays
Substrate bindingCharge reversal mutationsChanged substrate specificityMultiple substrate testing
Allosteric sitesCysteine substitutions for chemical modificationAltered regulationActivity modulation assays
  • Mutant Characterization Protocol:

    • Expression and purification under identical conditions as wild-type

    • Structural integrity verification (circular dichroism, thermal stability)

    • Comprehensive kinetic analysis with multiple substrates

    • Cofactor binding studies to evaluate affinity changes

This approach parallels successful studies of other bacterial enzymes, such as the investigation of YjeQ where a variant in the G1 motif (S221A) showed substantially impaired GTP hydrolysis, illuminating the importance of this residue for function .

How can contradictory kinetic data for YgjR be reconciled and interpreted?

When studying novel enzymes like YgjR, researchers often encounter seemingly contradictory kinetic data. A systematic approach to reconciliation includes:

  • Sources of Experimental Variability:

    • Differences in protein preparation (tags, purity, storage conditions)

    • Assay condition variations (buffer composition, pH, temperature)

    • Detection method sensitivities and artifacts

    • Batch-to-batch variation in reagents or equipment

  • Reconciliation Methodology:

    • Side-by-side comparison using standardized protocols

    • Careful control of all experimental variables

    • Statistical analysis of replicate measurements

    • Independent verification by different laboratory members

  • Advanced Kinetic Analysis Techniques:

    • Pre-steady state kinetics to identify burst phases or lag phases

    • Global fitting of data to complex kinetic models

    • Temperature-dependence studies to calculate activation parameters

    • Isotope effects to probe rate-limiting steps

In studies of other bacterial enzymes, such as YjeQ, researchers observed marked differences between pre-steady state and steady-state kinetics, with a burst of nucleotide hydrolysis for GTP (100 s⁻¹) compared to a steady-state rate of 9.4 h⁻¹ . This apparent discrepancy provided important mechanistic insights rather than representing contradictory data.

What structural biology approaches are most promising for determining YgjR structure?

Determining the three-dimensional structure of YgjR requires careful selection of appropriate techniques:

  • X-ray Crystallography Approach:

    • Protein construct optimization (remove flexible regions, surface entropy reduction)

    • Extensive crystallization condition screening (sparse matrix, grid screens)

    • Co-crystallization with cofactors or inhibitors to stabilize structure

    • Data collection at synchrotron facilities for optimal resolution

  • Cryo-Electron Microscopy Strategy:

    • Sample preparation optimization (concentration, buffer composition)

    • Grid preparation and vitrification protocol development

    • High-resolution data collection with direct electron detectors

    • Image processing and 3D reconstruction with current software packages

  • NMR Spectroscopy Considerations:

    • Domain-based approach if the full protein is too large

    • Isotopic labeling (¹⁵N, ¹³C) for resonance assignment

    • Structural restraint collection (NOEs, RDCs)

    • Structure calculation and refinement

  • Integrative Structural Biology:

    • Combination of low-resolution techniques (SAXS, HDX-MS)

    • Computational modeling with AlphaFold2 or RoseTTAFold

    • Validation with crosslinking mass spectrometry

    • Integration of all data sources for comprehensive structural models

Each approach has distinct advantages depending on protein characteristics, and a multi-technique strategy often yields the most comprehensive structural information. The successful structural characterization would provide crucial insights into YgjR's catalytic mechanism and substrate specificity.

How can computational approaches predict YgjR substrate specificity?

Computational prediction of YgjR's substrate specificity provides valuable direction for experimental validation:

  • Homology-Based Prediction Methods:

    • Identification of closest characterized homologs

    • Analysis of conserved active site residues

    • Comparison of binding pocket architecture

    • Phylogenetic profiling with enzymes of known function

  • Molecular Docking and Simulation:

    • Generation of protein structure models using AlphaFold2

    • Virtual screening of metabolite libraries

    • Binding energy calculation for potential substrates

    • Molecular dynamics simulations to assess binding stability

  • Machine Learning Approaches:

MethodTraining DataFeaturesValidation Strategy
Random ForestKnown oxidoreductase-substrate pairsSequence and structural featuresCross-validation
Neural NetworksEnzyme-metabolite interaction dataPhysicochemical descriptorsIndependent test set
Graph Convolutional NetworksProtein-ligand complexesStructural interaction patternsExperimental testing
Support Vector MachinesEnzymatic reaction databasesCofactor requirements, reaction typesPerformance metrics
  • Integration with Systems Biology:

    • Metabolic network analysis to identify potential substrates

    • Gene context and co-expression data to suggest functional relationships

    • Comparative genomics to highlight conserved metabolic roles

    • Metabolic modeling to evaluate thermodynamic feasibility

This multi-faceted computational approach generates testable hypotheses about YgjR function and prioritizes potential substrates for experimental validation, similar to approaches that might have been used for analyzing other uncharacterized proteins .

What evolutionary insights can be gained from analyzing YgjR homologs across bacterial species?

Evolutionary analysis of YgjR provides valuable context for understanding its function and significance:

  • Phylogenetic Analysis Methodology:

    • Comprehensive sequence collection from diverse bacterial phyla

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Phylogenetic model selection and tree construction

    • Ancestral sequence reconstruction at key evolutionary nodes

  • Comparative Genomics Approaches:

    • Synteny analysis to examine conservation of genomic context

    • Gene neighborhood analysis to identify functional associations

    • Analysis of horizontal gene transfer events

    • Correlation with specific metabolic capabilities across species

  • Ancestral Sequence Reconstruction Applications:

    • Resurrection of ancestral proteins for functional characterization

    • Tracking the acquisition of specific catalytic capabilities

    • Identifying key mutations that defined functional divergence

    • Understanding adaptation to different environmental niches

Similar approaches have been successfully applied to understand the evolution of other oxidoreductase families, as mentioned in research where ancestral sequence reconstruction was used to elucidate the evolutionary history of flavin-containing monooxygenases and Baeyer-Villiger monooxygenases .

How can systems biology approaches integrate YgjR into the broader metabolic network of E. coli?

Integrating YgjR into E. coli's metabolic network requires multi-omics approaches:

  • Transcriptomics Integration:

    • RNA-seq comparing wild-type and ygjR knockout strains

    • Identification of differentially expressed genes

    • Co-expression network construction

    • Transcription factor binding site analysis

  • Proteomics Strategies:

    • Global proteome analysis using mass spectrometry

    • Protein-protein interaction studies (AP-MS, BioID)

    • Post-translational modification mapping

    • Protein abundance changes in response to metabolic shifts

  • Metabolomics Investigations:

    • Untargeted metabolite profiling using LC-MS

    • Stable isotope labeling to track metabolic flux

    • Comparison of metabolite profiles between strains

    • Identification of accumulated or depleted metabolites

  • Computational Network Integration:

Integration MethodData Types CombinedAnalytical ToolsExpected Insights
Correlation networksTranscriptomics, proteomicsWGCNA, NetworkAnalystCo-regulated pathways
Bayesian networksMulti-omics dataBNlearn, BANJOCausal relationships
Genome-scale metabolic modelsFluxomics, metabolomicsCOBRApy, MATLABMetabolic flux predictions
Knowledge-based integrationLiterature, databasesCytoscape, STRINGContextual functional associations

This integrated approach provides a holistic view of YgjR's role in cellular metabolism and identifies promising directions for further focused studies, similar to comprehensive strategies used for other oxidoreductases .

How do environmental conditions affect YgjR expression and activity regulation?

Understanding environmental regulation of YgjR provides insights into its physiological role:

  • Transcriptional Regulation Analysis:

    • RNA-seq under various growth conditions

    • Promoter analysis to identify regulatory elements

    • Chromatin immunoprecipitation to identify transcription factors

    • Reporter gene assays to validate regulatory mechanisms

  • Environmental Variables to Systematically Test:

    • Carbon source variations (glucose, glycerol, acetate)

    • Oxygen availability (aerobic, microaerobic, anaerobic)

    • Stress conditions (oxidative, pH, osmotic, temperature)

    • Growth phase dependency (lag, log, stationary)

  • Post-translational Regulation Investigation:

    • Phosphorylation states using phosphoproteomics

    • Protein stability under different conditions

    • Potential allosteric regulation by metabolites

    • Protein-protein interactions affecting activity

  • Activity Modulation Characterization:

    • Enzyme kinetics across environmental conditions

    • Cofactor availability effects

    • pH and ionic strength dependencies

    • Temperature effects on activity and stability

This comprehensive approach parallels strategies used to understand environmental regulation of other bacterial enzymes, providing a framework for elucidating YgjR's role in E. coli physiology and its potential adaptation to different environmental niches.

What statistical approaches are most appropriate for analyzing YgjR enzyme kinetics data?

  • Experimental Design Considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization of sample processing

    • Inclusion of appropriate controls

    • Blocking and stratification to control for confounding variables

  • Data Preprocessing Requirements:

    • Outlier detection and handling

    • Normality testing and appropriate transformations

    • Homogeneity of variance assessment

    • Baseline correction and background subtraction

  • Statistical Test Selection Framework:

Data TypeRecommended AnalysisSoftware ImplementationKey Parameters to Report
Enzyme kineticsNon-linear regressionGraphPad Prism, RKm, Vmax, kcat with 95% CI
Inhibition studiesGlobal fitting to inhibition modelsDynaFit, KinTek ExplorerKi values, inhibition mechanism
pH/temperature profilesGaussian or bell-shaped curve fittingOrigin, ROptimal conditions, inflection points
Multiple condition comparisonTwo-way ANOVA with post-hoc testsR, SPSSF-statistics, p-values, effect sizes
  • Advanced Statistical Approaches:

    • Bayesian methods for complex models

    • Bootstrapping for robust confidence intervals

    • Multivariate analysis for multiple response variables

    • Mixed-effects models for nested experimental designs

What are best practices for designing control experiments when characterizing YgjR?

Robust control experiments are essential for reliable characterization of YgjR:

  • Negative Controls:

    • Heat-denatured enzyme preparations

    • Catalytic site mutants (inactive enzyme)

    • Reaction mixtures lacking essential cofactors

    • Buffer-only controls to assess background reactions

  • Positive Controls:

    • Well-characterized oxidoreductases with similar activity

    • Chemical reactions that mimic enzymatic activity

    • Complementation assays in knockout strains

    • Known substrates for related enzymes

  • Specificity Controls:

    • Substrate analogs with modified structures

    • Competitive inhibitors to demonstrate binding specificity

    • Alternative cofactors to test cofactor specificity

    • Non-substrate compounds with similar chemical properties

  • Validation Controls:

    • Independent methods to verify activity measurements

    • Biological replicates from independent protein preparations

    • Tests across multiple laboratories when possible

    • Orthogonal assays measuring different aspects of the same reaction

These control experiments help distinguish true enzymatic activity from artifacts and provide confidence in the specificity and mechanism of YgjR, similar to the rigorous control experiments employed in the characterization of other uncharacterized proteins .

How can isotope labeling techniques advance understanding of YgjR reaction mechanisms?

Isotope labeling provides powerful insights into YgjR's catalytic mechanism:

  • Kinetic Isotope Effect (KIE) Studies:

    • Deuterium-labeled substrates to identify rate-limiting steps

    • ¹⁸O labeling to track oxygen incorporation in products

    • ¹⁵N or ¹³C labeling to follow atom transfer reactions

    • Multiple KIE measurements to develop full mechanistic models

  • Reaction Intermediate Identification:

    • Rapid quench techniques to trap labeled intermediates

    • Mass spectrometry to identify transient species

    • NMR analysis of isotopically enriched reaction mixtures

    • Computational modeling to interpret experimental data

  • Metabolic Flux Analysis Applications:

IsotopeApplicationDetection MethodMechanistic Insight
²H (Deuterium)Primary KIE studiesMass spectrometryRate-limiting C-H bond cleavage
¹⁸OOxygen incorporationMass spectrometry, IRSource of oxygen atoms in products
¹³CCarbon transfer trackingNMR, mass spectrometryCarbon skeleton rearrangements
¹⁵NNitrogen metabolismNMR, mass spectrometryTransamination mechanisms
  • In Vivo Tracing Experiments:

    • Feeding labeled precursors to living cells

    • Tracking isotope incorporation into metabolites

    • Comparing wild-type and ygjR knockout strains

    • Integrating with metabolic models

These approaches have proven valuable for elucidating the mechanisms of other oxidoreductases and would provide deep insights into YgjR's specific catalytic capabilities and physiological role.

What publication standards should be followed when reporting novel findings about YgjR?

Comprehensive and transparent reporting is essential for advancing knowledge about YgjR:

  • Experimental Methods Documentation:

    • Complete protein production and purification protocols

    • Detailed composition of all buffers and reaction mixtures

    • Specific assay conditions including temperature, pH, and time

    • Equipment specifications and calibration details

  • Data Presentation Standards:

    • Raw data availability in repositories or supplements

    • Clear labeling of axes with units

    • Appropriate error representation (SD, SEM, 95% CI)

    • Complete figure legends that can stand alone

  • Statistical Reporting Requirements:

    • Sample sizes and number of independent replicates

    • Statistical tests used with justification

    • Exact p-values rather than ranges

    • Effect sizes in addition to statistical significance

  • Reproducibility Enhancements:

    • Deposition of data in appropriate repositories

    • Sharing of analysis code and scripts

    • Detailed methods sections that enable replication

    • Disclosure of negative or contradictory results

This approach aligns with the detailed reporting seen in publications of other uncharacterized proteins, ensuring that the research community can build upon findings, validate results, and advance collective understanding of YgjR's function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.