Recombinant Escherichia coli Uncharacterized protein yahG (yahG)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Biological Context

YahG remains uncharacterized in terms of precise enzymatic or structural roles, but homologs and genomic context provide clues:

Putative Roles in Cellular Processes

  • RNA metabolism: Proteins like YbcJ and YfgB (structurally related to YahG) interact with RNA helicases and exoribonucleases, suggesting roles in mRNA degradation or ribosomal assembly .

  • Translation fidelity: Deletion of ybcJ or yfgB reduces polysome formation and increases frameshift errors .

Genomic Linkages

  • YahG is encoded by the b0321 locus, adjacent to genes involved in stress response and metabolism, hinting at potential regulatory functions .

Applications in Research

YahG is primarily used in vaccine development and proteomic studies:

Vaccine Development

  • Serves as a component in experimental vaccines targeting pathogenic E. coli strains .

  • Demonstrated utility in antigenicity studies due to its surface-exposed epitopes .

Model for Recombinant Protein Production

  • Studies on E. coli M15 and DH5α strains reveal that mid-log phase induction in M9 medium maximizes YahG yield (40–60 mg/L) .

  • Key production parameters:

ParameterOptimal Condition (YahG)Impact on Yield
Induction phaseMid-log (OD₆₀₀ = 0.6)↑ Soluble protein
Culture mediumM9 + 2% glucose↑ Metabolic stability
Host strainE. coli M15↑ Transcriptional efficiency

Challenges in Production and Solubility

Metabolic Burden

  • Recombinant YahG expression downregulates fatty acid biosynthesis and amino acid metabolism in E. coli M15, reducing growth rates by 15–20% .

  • Proteomic profiling shows >50% of host proteins are downregulated during YahG production .

Refolding and Stability

  • Like other disulfide-bonded proteins, YahG requires oxidative refolding protocols to achieve native conformation .

  • Air oxidation in guanidine hydrochloride (GuHCl) improves correct disulfide pairing, as observed in homologous proteins .

Comparative Analysis of Related "Y" Proteins

Proteins with uncharacterized functions in E. coli often share roles in conserved systems:

ProteinLocusPutative Function Phenotype of Deletion
YbcJb0301RNA processing, degradosomeReduced translation fidelity
YfgBb0432Ribosomal assemblyAltered polysome ratios
YahGb0321Unknown (structural studies ongoing)Under investigation

Future Directions

  • Structural studies: NMR or cryo-EM to resolve YahG’s tertiary structure .

  • Functional assays: Knockout models to assess motility, biofilm formation, or stress response roles .

  • Biotechnological optimization: T7 RNA polymerase-driven systems to decouple growth and production phases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your preference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
yahG; b0321; JW0313; Uncharacterized protein YahG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-472
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yahG
Target Protein Sequence
MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQVVQALDNIADSPLAD KIAAANQQALERIIQSHPVLIGFDQAINVVPGMTAKTILHAGPPITWEKMCGAMKGAVTG ALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSASMFMHIVKNKTYGNIAY TNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKIIGEIDLRLMLAQALHMGDE CHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVASSDYFSGPTWMAMCKAAMDAAH GIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGPMFAGYKPEDSGLDIGDSAIT ETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITLGENPNVTIPLLGFMGVPSAID ITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFACFEKAILGWCERYGV
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW0313

STRING: 316407.85674464

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YahG protein and why is it classified as "uncharacterized"?

YahG is a protein encoded in the Escherichia coli genome whose biological function has not been definitively determined through experimental validation. Proteins are classified as "uncharacterized" when their physiological roles, biochemical activities, and structural properties remain largely unknown, despite their presence being confirmed through genomic analysis. Similar to other uncharacterized transcription factors in E. coli, YahG lacks comprehensive functional annotation despite being identified in the genome sequence . The systematic identification of uncharacterized proteins often requires integrated computational and experimental workflows to elucidate their biological functions, as demonstrated in approaches used for other E. coli proteins .

What expression systems are recommended for recombinant YahG production?

For recombinant YahG production, E. coli BL21(DE3) is highly recommended as it is engineered specifically for high-level protein expression. This strain contains the T7 RNA polymerase gene under control of the lacUV5 promoter, allowing for inducible expression using IPTG . When designing expression systems for uncharacterized proteins like YahG, optimizing the promoter is crucial. Recent research shows that engineered promoters, such as the enhanced P dacA-3 promoter with additional Shine-Dalgarno (SD) sequences, can significantly improve extracellular protein production in E. coli . For example, inserting one SD sequence between the promoter and target gene increased recombinant amylase activities by 2.0-fold compared to control systems .

How can I optimize soluble expression of recombinant YahG protein?

Soluble expression of recombinant YahG can be optimized through systematic experimental design methodology. Key parameters to consider include:

  • Temperature: Lower induction temperatures (15-25°C) often increase soluble protein yield by slowing folding kinetics

  • Inducer concentration: Titrating IPTG concentration from 0.1-1.0 mM to find optimal induction level

  • Media composition: Enriched media like TB (Terrific Broth) or auto-induction media can increase biomass and protein yield

  • Co-expression with chaperones: DnaK, GroEL/ES, or trigger factor can assist proper folding

Implementing a design of experiments (DOE) approach allows for systematic testing of these parameters simultaneously rather than using one-factor-at-a-time methods. Researchers have achieved high-level soluble expression (up to 250 mg/L) of recombinant proteins in E. coli using such methodologies . For proteins similar to YahG, this approach has led to up to 75% homogeneity in the recovered active protein .

What purification strategies are most effective for YahG protein?

The most effective purification strategy for YahG will depend on the expression construct design. For research-scale production, affinity chromatography using a fusion tag represents the most efficient first-step purification method. Common options include:

  • His-tag purification: Using a 6x histidine tag and IMAC (Immobilized Metal Affinity Chromatography)

  • GST-tag: Glutathione S-transferase fusion followed by glutathione affinity purification

  • MBP-tag: Maltose-binding protein fusion for enhanced solubility and affinity purification

For further purification, size exclusion chromatography (SEC) and ion exchange chromatography can be employed sequentially. The choice of tag should consider potential interference with protein function, as experimental approaches used with other uncharacterized E. coli proteins have shown that tag placement can affect protein activity and binding properties . Purification protocols should be optimized based on protein characteristics such as molecular weight, isoelectric point, and stability conditions.

How can I design experiments to determine the biological function of YahG?

Determining the biological function of YahG requires a multi-faceted experimental approach that combines computational prediction with in vivo and in vitro validation:

  • Computational analysis: Begin with bioinformatic approaches to predict potential DNA-binding domains, which may indicate if YahG functions as a transcription factor .

  • Condition prediction: Analyze gene expression data under various growth conditions to identify when yahG is expressed, suggesting conditions for functional studies .

  • Experimental validation design:

    • Generate yahG gene knockout strains

    • Perform phenotypic characterization under various stress conditions

    • Compare growth rates, metabolic profiles, and transcriptional responses

    • Use ChIP-exo combined with transcription profiling to identify potential DNA binding sites if YahG is predicted to be a transcription factor

  • Functional validation:

    • Perform targeted biochemical assays based on predicted functions

    • Use RNA-seq to identify differentially expressed genes in knockout strains

    • Validate protein-protein interactions using pull-down assays or bacterial two-hybrid systems

This integrated workflow has successfully elucidated the biological functions of previously uncharacterized transcription factors in E. coli, including YiaJ, YdcI, and YeiE, through in-depth analysis of mutant phenotypes .

What statistical approaches should I use for analyzing differential expression of YahG under various conditions?

When analyzing differential expression of YahG under various conditions, robust statistical approaches are essential. Consider the following methodologies:

  • Experimental design optimization:

    • Implement blocking to account for known sources of variability

    • Consider both biological replicates (different bacterial cultures) and technical replicates (repeated measurements from the same culture)

    • Design experiments with sufficient replication to detect meaningful differences (typically minimum 3 biological replicates and 2 technical replicates)

  • Statistical testing frameworks:

    • Apply linear mixed models that account for both fixed effects (experimental conditions) and random effects (biological variation)

    • Use appropriate transformations (log2) for gene expression data to achieve normality

    • Control for multiple testing using methods such as Benjamini-Hochberg procedure to limit false discovery rate (FDR)

  • Decision rules for significance:

    • Define significance thresholds (typically p < 0.05) with appropriate multiple testing correction

    • Consider fold-change thresholds in addition to statistical significance

    • Evaluate both false positive (FPos) and false negative rates in your analysis

For example, when testing differential expression across multiple conditions, if analyzing 1000 proteins/genes with α = 0.05, up to 50 could be falsely detected as differentially expressed by chance alone . Therefore, implementing proper statistical controls is critical for reliable results.

How can I determine if YahG functions as a transcription factor and identify its regulon?

To determine if YahG functions as a transcription factor and identify its regulon, implement the following systematic approach:

  • Domain analysis and structural prediction:

    • Analyze the protein sequence for known DNA-binding domains using tools like PFAM, PROSITE, or HMMER

    • Predict tertiary structure using AlphaFold2 or similar tools to identify potential DNA-binding motifs

  • DNA-binding capability assessment:

    • Perform Electrophoretic Mobility Shift Assays (EMSA) with purified YahG protein

    • Conduct DNase I footprinting to identify protected DNA regions

    • Implement ChIP-seq or ChIP-exo to map genome-wide binding sites in vivo

  • Transcriptome analysis:

    • Compare RNA-seq data between wild-type and yahG deletion strains under various conditions

    • Identify differentially expressed genes that may constitute the YahG regulon

    • Validate by qRT-PCR for selected target genes

  • Motif discovery and validation:

    • Use bioinformatic tools (MEME, FIMO) to identify enriched sequence motifs in ChIP-seq peaks

    • Validate predicted binding motifs using synthetic oligonucleotides in vitro

    • Perform reporter gene assays with wild-type and mutated binding sites

This integrated approach has been successfully applied to characterize several previously uncharacterized transcription factors in E. coli, revealing their biological functions and regulatory networks . The combination of ChIP-exo with transcription profiling has been particularly effective for describing regulons of major E. coli transcription factors .

What are the key considerations for experimental design when studying the impact of YahG overexpression on cellular physiology?

When studying the impact of YahG overexpression on cellular physiology, consider these key experimental design factors:

  • Expression system selection:

    • Choose between chromosomal integration versus plasmid-based expression

    • Consider copy number effects (low, medium, or high-copy plasmids)

    • Select appropriate promoters (constitutive vs. inducible)

    • Evaluate the effect of adding Shine–Dalgarno (SD) sequences to enhance expression

  • Experimental design structure:

    • Implement randomized complete block design to control for batch effects

    • Account for both biological and technical variability sources

    • Consider time-course experiments to capture dynamic responses

  • Phenotypic characterization approach:

    • Monitor growth parameters (rate, yield, lag phase)

    • Assess morphological changes through microscopy

    • Measure membrane permeability changes, as YahG overexpression may affect cell envelope properties similar to DacA

    • Analyze global transcriptional responses through RNA-seq

    • Measure metabolic changes through targeted or untargeted metabolomics

  • Controls and validation:

    • Include proper controls (empty vector, overexpression of unrelated protein)

    • Validate protein expression levels through Western blotting

    • Confirm functionality through complementation studies

    • Use multiple strains to ensure reproducibility of phenotypes

How can I integrate proteomics data with metabolic models to understand YahG's role in E. coli physiology?

Integrating proteomics data with metabolic models to understand YahG's role requires a systems biology approach:

  • Proteomics experimental design:

    • Design proper sampling protocols with sufficient biological and technical replicates

    • Consider both the biological phase (different cultures) and technical phase (protein extraction and analysis) in your experimental design

    • Implement randomization or blocking strategies to minimize systematic biases

    • Use appropriate statistical methods that account for the hierarchical nature of the data

  • Data integration framework:

    • Map identified proteins to metabolic pathways in genome-scale metabolic models (GEMs) like iML1515 for E. coli

    • Apply constraint-based modeling approaches such as Flux Balance Analysis (FBA)

    • Use proteomics data to constrain flux distributions in the metabolic model

    • Implement approaches similar to those used for integrating transcriptional regulatory networks (TRNs) with metabolic models

  • Regulatory network inference:

    • Infer regulatory interactions using expression data-driven approaches

    • Apply regulon-based association methods to identify co-regulated genes

    • Implement integrated analysis with metabolic models as described for other E. coli regulatory systems

  • Validation experiments:

    • Test model predictions with targeted experiments

    • Validate predicted metabolic changes through metabolomics

    • Confirm regulatory interactions through ChIP-seq or similar approaches

What are the best methods for studying protein-protein interactions involving YahG?

The optimal methods for studying protein-protein interactions (PPIs) involving YahG include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged YahG in E. coli

    • Perform pull-down experiments under physiological conditions

    • Identify interacting partners through LC-MS/MS

    • Implement proper controls (untagged strains, irrelevant tagged protein)

    • Quantify interaction strength using label-free or labeled quantification methods

  • Bacterial two-hybrid (B2H) system:

    • Clone yahG into appropriate B2H vectors

    • Screen against genomic library or candidate interaction partners

    • Validate positive interactions with secondary assays

    • Consider reverse B2H approaches for confirmation

  • In vivo crosslinking approaches:

    • Use formaldehyde or photoactivatable crosslinkers to capture in vivo interactions

    • Perform immunoprecipitation followed by Western blotting or MS analysis

    • Apply DSSO or similar MS-cleavable crosslinkers for detailed interaction site mapping

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions (YahG-CFP, candidate partner-YFP)

    • Measure energy transfer as indication of protein proximity

    • Perform controls to ensure fusion proteins maintain native function

When analyzing PPI data, apply appropriate statistical frameworks similar to those used in proteomics studies to distinguish true interactions from background. Consider both the biological and technical variability in your experimental design to ensure robust identification of interaction partners.

How should I approach the structural characterization of the YahG protein?

A comprehensive approach to structural characterization of YahG should include:

  • Protein expression and purification optimization:

    • Optimize soluble expression using experimental design methodology

    • Test different fusion tags (His, GST, MBP) to enhance solubility and purification

    • Implement buffer screening to identify conditions maintaining protein stability

    • Achieve at least 75% homogeneity through optimized purification protocols

  • Secondary structure analysis:

    • Perform circular dichroism (CD) spectroscopy to determine α-helix and β-sheet content

    • Use differential scanning calorimetry (DSC) to assess thermal stability

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

  • Tertiary structure determination:

    • Prioritize based on feasibility:
      a. X-ray crystallography: Optimize crystallization conditions through high-throughput screening
      b. Cryo-electron microscopy: Especially valuable if YahG forms larger complexes
      c. NMR spectroscopy: Applicable if protein size is suitable (<30 kDa)

    • Complement experimental approaches with AlphaFold2 or RoseTTAFold predictions

  • Functional structural elements identification:

    • Perform limited proteolysis to identify stable domains

    • Use site-directed mutagenesis of predicted functional residues

    • Apply cross-linking mass spectrometry to identify intramolecular contacts

Following structural characterization, functional assays should be designed based on structural insights to validate the relationship between structure and function, similar to approaches used for other uncharacterized E. coli proteins .

What strategies can overcome challenges in detecting low-abundance YahG expression in native conditions?

Detecting low-abundance YahG expression in native conditions requires specialized strategies:

  • Enhanced mass spectrometry approaches:

    • Implement targeted proteomics methods like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM)

    • Use data-independent acquisition (DIA) methods with spectral libraries

    • Apply fractionation techniques to reduce sample complexity

    • Consider AQUA peptides for absolute quantification of YahG

    • Implement proper statistical analysis methods as used in proteomics studies

  • Enrichment techniques:

    • Develop specific antibodies against YahG for immunoprecipitation

    • Apply affinity enrichment using predicted interaction partners

    • Create chromosomal epitope-tagged versions of yahG gene to enable enrichment while maintaining native expression levels

  • Transcriptional analysis alternatives:

    • Use highly sensitive qRT-PCR to monitor yahG mRNA levels

    • Implement digital droplet PCR (ddPCR) for absolute quantification

    • Consider RNA-seq with sufficient depth (>50M reads) to capture low-abundance transcripts

  • Reporter systems for indirect detection:

    • Generate transcriptional fusions (yahG promoter driving luciferase or fluorescent protein)

    • Create translational fusions that maintain regulatory elements

    • Apply ribosome profiling to assess translation efficiency of yahG mRNA

When designing experiments for low-abundance proteins, consider randomized designs without blocking as shown in proteomics studies to capture both biological and technical variability across different culture conditions and technical parameters.

How can I use comparative genomics to gain insights into YahG function?

Comparative genomics offers valuable insights into YahG function through the following structured approach:

  • Ortholog identification and analysis:

    • Identify YahG orthologs across bacterial species using reciprocal BLAST or OrthoMCL

    • Generate multiple sequence alignments to identify conserved domains and residues

    • Construct phylogenetic trees to understand evolutionary relationships

    • Map conservation patterns to predicted structural features

  • Genomic context analysis:

    • Examine gene neighborhood conservation (synteny analysis)

    • Identify co-occurring genes that may function in the same pathway

    • Apply guilt-by-association approaches to infer function from genomic context

    • Look for patterns in operonic organization across species

  • Evolutionary pressure analysis:

    • Calculate dN/dS ratios to identify regions under selection

    • Perform Mutual Information analysis to identify co-evolving residues

    • Apply evolutionary coupling analysis to predict structural contacts

  • Integration with experimental data:

    • Correlate conservation patterns with available experimental data

    • Design validation experiments targeting highly conserved regions

    • Test functional predictions through comparative phenotypic analysis

    • Apply similar approaches to those used for other uncharacterized transcription factors in E. coli

This comparative genomics framework has proven effective for other uncharacterized proteins, providing testable hypotheses about protein function based on evolutionary conservation patterns and genomic context.

What are the current knowledge gaps regarding YahG and how should research priorities be established?

The current knowledge landscape for YahG presents several significant gaps that should guide research priorities:

  • Fundamental characterization gaps:

    • Basic expression patterns under various growth conditions

    • Subcellular localization and potential membrane association

    • Structure-function relationships and identification of functional domains

    • Integration in known regulatory networks

  • Recommended research priority framework:

    • High priority: Determine expression conditions and basic biochemical characteristics

    • Medium priority: Identify interaction partners and potential regulatory targets

    • Long-term goals: Elucidate the precise molecular mechanism and physiological relevance

  • Strategic research approach:

    • Begin with systematic profiling of expression patterns across growth conditions

    • Generate clean deletion mutants and characterize phenotypes

    • Apply systems biology approaches to position YahG in the E. coli regulatory network

    • Use experimental design methodologies that account for both biological and technical variation

Understanding YahG function would benefit from integrated computational and experimental workflows similar to those successfully applied to elucidate the biological functions of other uncharacterized transcription factors in E. coli . This would include examining DNA-binding domains, predicting active conditions, and performing in vivo experimental validation of predicted capabilities.

How can new technologies be applied to accelerate understanding of YahG function?

Emerging technologies offer promising approaches to accelerate understanding of YahG function:

  • CRISPR-based technologies:

    • Apply CRISPRi for titratable repression of yahG expression

    • Use CRISPR-Cas9 for precise genomic modifications to create reporter fusions

    • Implement CRISPR activation systems to enhance native expression

    • Develop CRISPR-based screens to identify genetic interactions

  • Single-cell approaches:

    • Apply single-cell RNA-seq to identify cell-to-cell variability in yahG expression

    • Use time-lapse microscopy with fluorescent reporters to track expression dynamics

    • Implement microfluidics to study expression under changing environmental conditions

  • Proximity labeling methods:

    • Apply APEX2 or BioID fusion strategies to identify proximal proteins in vivo

    • Use spatially-resolved proteomics to map YahG's localization and interaction network

    • Combine with mass spectrometry for high-throughput interaction mapping

  • Data integration platforms:

    • Implement machine learning approaches to predict function from multi-omics data

    • Use network analysis tools to position YahG in the E. coli regulatory network

    • Apply similar approaches to those used for TRN reconstruction in E. coli

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.