Recombinant Escherichia coli Uncharacterized protein ybfB (ybfB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Uncharacterized Protein ybfB (ybfB)

Recombinant Escherichia coli uncharacterized protein ybfB (ybfB) refers to a bioengineered version of the native ybfB protein derived from E. coli strain K-12. This protein remains functionally uncharacterized in the scientific literature, though its recombinant form is commercially available for research purposes. The ybfB gene encodes a 108-amino-acid polypeptide (aa 1–108) and belongs to a group of "y-genes" in E. coli that are poorly understood but may play roles in stress response, metabolic regulation, or pathogenicity .

Key Features

PropertyDetails
Source StrainE. coli K-12 MG1655
Amino Acid Sequence1–108 residues (exact sequence not publicly disclosed in available sources)
Expression SystemsE. coli, yeast, baculovirus, or mammalian cells (depending on supplier)
Purity>90% (estimated based on industry standards for recombinant proteins)
ApplicationsVaccine development, structural studies, protein interaction assays

The recombinant ybfB protein is often produced using standard bacterial expression systems, such as E. coli BL21(DE3) or specialized strains optimized for soluble protein production . Challenges in expressing ybfB may include misfolding or aggregation, common issues in recombinant protein production .

Potential Biological Roles

While ybfB’s native function remains uncharacterized, its classification as a "y-gene" suggests involvement in niche biological processes. Similar uncharacterized proteins in E. coli often regulate stress responses, membrane transport, or interactions with host environments . For example:

  • Pathogenicity: Some uncharacterized E. coli proteins modulate virulence or evade host immune systems .

  • Metabolic Adaptation: Unstudied proteins may regulate metabolic pathways under specific growth conditions .

Applications in Research

ApplicationDetails
Vaccine DevelopmentUsed as a candidate antigen for eliciting immune responses (e.g., in pathogenic E. coli strains) .
Structural StudiesEmployed to resolve 3D structures via crystallography or cryo-EM.
Protein InteractionScreened for binding partners using affinity chromatography or yeast two-hybrid assays.

No specific studies directly linking ybfB to functional roles have been reported in peer-reviewed literature. Its utility in vaccine development remains speculative but aligns with broader trends in using uncharacterized antigens for therapeutic targets .

Production Limitations

  1. Inclusion Body Formation: High expression levels in E. coli may lead to aggregation, necessitating solubility enhancers (e.g., chaperones like GroEL/GroES) .

  2. Lack of Functional Data: Limited biochemical or genetic studies hinder hypothesis-driven research.

Research Gaps

  • Molecular Mechanism: No known binding motifs or interaction partners.

  • Regulatory Pathways: Unknown upstream regulators or downstream targets.

Strategic Opportunities

  • High-Throughput Screening: Use ybfB in proteomic arrays to identify interacting proteins.

  • CRISPR-Based Knockouts: Study phenotypes in E. coli ΔybfB mutants to infer function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format preferences, kindly note your requirements during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance for necessary arrangements and associated charges.
Notes
Repeated freezing and thawing cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can utilize this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ybfB; b0702; JW0691; Uncharacterized protein YbfB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ybfB
Target Protein Sequence
MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFI ALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the predicted functional associations of ybfB?

While ybfB remains functionally uncharacterized, protein interaction network analysis through databases like STRING reveals several potential functional associations:

ProteinFunctionConfidence Score
rhaML-rhamnose mutarotase0.893
yjaHDUF1481 family putative lipoprotein0.808
ybiCPutative dehydrogenase0.806
rhsCRhs protein with putative toxin domain0.798
ybfADUF2517 family protein0.784
ybfCUncharacterized protein YbfC0.747
ydePPutative oxidoreductase0.731

These interactions suggest potential involvement in carbohydrate metabolism (via rhaM), membrane processes (via yjaH and ybfA), and possibly stress response pathways (via ydeP) . The strong association with ybfA is particularly noteworthy, as ybfA has been shown to regulate E. coli sensitivity to bacteriocins via the BasS/BasR two-component system .

Experimental validation of these predictions would typically involve co-immunoprecipitation, bacterial two-hybrid assays, or crosslinking mass spectrometry.

What expression and purification methods are recommended for recombinant ybfB?

Expression and purification of recombinant ybfB requires specific approaches suited to membrane proteins:

Recommended expression system:

  • E. coli BL21(DE3) or similar strains with pET-based vectors

  • N-terminal His-tag fusion (as demonstrated in commercial preparations)

  • Controlled induction (typically 0.1-0.5 mM IPTG) at lower temperatures (18-25°C)

Purification protocol:

  • Cell lysis via sonication or mechanical disruption in buffer containing mild detergents (e.g., n-dodecyl-β-D-maltopyranoside)

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization with appropriate detergent

  • IMAC purification using Ni-NTA resin

  • Size exclusion chromatography for final polishing

Buffer composition:

  • Base buffer: Tris/PBS-based buffer, pH 8.0

  • Additives: 6% Trehalose as stabilizer

  • Detergent: Maintained above critical micelle concentration

Storage recommendations include aliquoting purified protein and flash-freezing, avoiding repeated freeze-thaw cycles. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with glycerol (30-50%) added for long-term storage at -20°C/-80°C .

How can gene knockout studies be designed to investigate ybfB function?

Systematic gene knockout studies provide crucial insights into ybfB function:

Knockout construction approaches:

  • Lambda Red recombination system, as described for complementation studies of related genes

  • CRISPR-Cas9 based genome editing

  • P1 phage transduction from existing knockout collections (e.g., Keio collection strain JW0691)

Essential control experiments:

  • Complementation with wild-type ybfB to confirm phenotype specificity

  • RT-PCR to verify complete knockout and absence of polar effects on neighboring genes

  • Growth curve analysis under multiple conditions to identify subtle phenotypes

Phenotypic screening parameters:

  • Growth in various carbon sources and under different stress conditions

  • Membrane integrity assays (using fluorescent dyes)

  • Antibiotic susceptibility testing, particularly for membrane-targeting compounds

  • Microscopic analysis of cell morphology

The resulting phenotypic data can be analyzed using statistical methods similar to those used in transcriptomic studies, with adjusted P values ≤0.01 considered significant .

How can computational approaches be used to predict ybfB function?

Computational function prediction for uncharacterized proteins like ybfB involves integrating multiple approaches:

Structure-based function prediction:

  • Generate 3D structure predictions using AlphaFold or RoseTTAFold

  • Compare predicted binding sites to libraries of known functional sites

  • Validate predictions via molecular dynamics simulations

  • Calculate binding free energies for potential ligands

This approach was successfully applied to the Tm1631 protein from Thermotoga maritima, revealing unexpected DNA binding capabilities despite lack of sequence homology to known DNA-binding proteins .

Sequence-based approaches:

  • Conserved domain analysis and superfamily classification

  • Genomic context analysis (gene neighborhood conservation)

  • Phylogenetic profiling to identify co-evolved genes

Integration with experimental data:

  • Network-based function prediction using high-confidence protein interactions

  • Co-expression analysis across multiple conditions

  • Incorporation of phenotypic data from related genes

Machine learning methods can further improve predictions by integrating multiple features. For validation, researchers should design focused experiments based on the highest confidence predictions rather than attempting random functional screens.

What is the relationship between ybfB and the BasS/BasR two-component system?

While direct evidence linking ybfB to BasS/BasR is limited, several lines of research suggest potential connections:

  • Protein interaction data shows high confidence association between ybfB and ybfA (0.784 score)

  • YbfA has been shown to affect sensitivity to antimicrobial compounds (plantaricin BM-1) via the BasS/BasR two-component system

  • BasS/BasR regulates genes involved in membrane modifications and stress responses

To investigate this relationship, researchers could:

Experimental approaches:

  • Compare transcriptional profiles between wild-type, ΔybfB, ΔbasS/basR, and double mutants

  • Analyze BasR binding to ybfB promoter using ChIP-seq

  • Examine ybfB expression in response to BasS/BasR-activating conditions

  • Test antimicrobial sensitivity profiles in various genetic backgrounds

These studies would help determine whether ybfB acts upstream, downstream, or independently of the BasS/BasR system in membrane-related stress responses.

How can proteomics be applied to characterize ybfB function in vivo?

Proteomics offers powerful approaches for characterizing uncharacterized proteins like ybfB:

Comparative proteomics strategies:

  • Global proteome comparison between wild-type and ΔybfB strains under various conditions

  • SILAC or TMT labeling for quantitative comparison

  • Phosphoproteomics analysis to identify affected signaling pathways

  • Membrane proteome enrichment to focus on relevant subcellular fraction

Interaction proteomics:

  • Affinity purification using tagged ybfB coupled with mass spectrometry

  • Proximity labeling using BioID or APEX2 fused to ybfB

  • Crosslinking mass spectrometry to identify direct binding partners

  • Protein correlation profiling across membrane fractions

Analysis of large-scale proteomics data requires statistical approaches similar to those used in transcriptomics, with appropriate corrections for multiple testing . Proteomics data should be integrated with transcriptomic and genetic analyses to develop a comprehensive model of ybfB function.

What are the challenges and solutions for structural characterization of ybfB?

Structural characterization of membrane proteins like ybfB presents unique challenges:

Technical challenges:

  • Low expression yields typical of membrane proteins

  • Protein instability outside the membrane environment

  • Difficulty in obtaining diffraction-quality crystals

  • Detergent micelle interference with crystallization

Methodological solutions:

  • Screen multiple expression systems and fusion partners to improve yields

  • Utilize membrane mimetics (nanodiscs, bicelles, lipidic cubic phase)

  • Apply surface entropy reduction to enhance crystallization propensity

  • Consider detergent-free approaches such as styrene maleic acid lipid particles (SMALPs)

Alternative structural techniques:

  • Cryo-electron microscopy (cryo-EM) for detergent-solubilized protein

  • Solid-state NMR spectroscopy for membrane-embedded structures

  • SAXS/SANS for low-resolution envelope determination

  • HDX-MS for conformational dynamics information

Crystallization conditions should be systematically explored, considering parameters like pH and precipitant concentration, which have been shown to significantly affect crystallization success . Researchers should also explore antibody fragment co-crystallization, which has proven effective for many challenging membrane proteins.

How might ybfB be involved in bacterial stress responses?

The potential role of ybfB in stress responses can be investigated through multiple approaches:

Transcriptional regulation analysis:

  • qRT-PCR analysis of ybfB expression under various stress conditions using methods similar to those described by Pfaffl

  • Promoter-reporter fusion studies to identify stress-responsive elements

  • Comparison with transcriptomic data from known stress response regulons

Phenotypic characterization:

  • Growth and survival assays comparing wild-type and ΔybfB strains under stress conditions

  • Membrane integrity assessment during stress using fluorescent probes

  • Competitive fitness assays in mixed populations under stress

Connection to known stress response pathways:

  • Epistasis analysis with genes from BasS/BasR regulon

  • Evaluation of stress-induced modifications or processing of ybfB

  • Localization studies during stress response activation

The strong interaction between ybfB and ybfA , which plays a role in bacteriocin sensitivity , suggests potential involvement in membrane stress responses particularly related to antimicrobial challenges.

How can ybfB research benefit from newer AI-driven research tools?

AI-driven research tools offer significant advantages for studying uncharacterized proteins like ybfB:

AI tools for literature analysis:

  • Consensus - for identifying scientific consensus on specific questions related to membrane proteins

  • Elicit.org - for intelligent research assistance in finding relevant papers

  • Scite.ai - for obtaining verified citations and tracking scientific claims about membrane proteins

AI in structural biology:

  • AlphaFold and RoseTTAFold for structure prediction

  • Molecular dynamics simulation analysis and trajectory interpretation

  • Virtual screening of potential ligands and binding partners

Data integration approaches:

  • Research Rabbit for exploring the scholarly network around ybfB and related proteins

  • Machine learning for phenotype prediction from multi-omics data

  • Network-based function prediction incorporating protein-protein interaction data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.