Recombinant Escherichia coli Uncharacterized protein ybhM (ybhM)

What is the ybhM protein in Escherichia coli?

The ybhM protein (UniProt ID: P75769) is an uncharacterized membrane protein in Escherichia coli consisting of 237 amino acids . Sequence analysis suggests it contains multiple transmembrane domains with a characteristic amino acid sequence pattern indicative of membrane integration. Current structural predictions indicate it may function as a transporter or channel protein, though its precise biological role remains to be elucidated through experimental characterization .

What are the predicted structural features of the ybhM protein?

Based on bioinformatic analyses, ybhM is predicted to contain multiple hydrophobic regions that likely form transmembrane helices. The amino acid sequence (MESYSQNSNKLDFQHEARILNGIWLITALGLVATAGLAWGAKYIEITATKY DSPPMYVAIGLLLLCMYGLSKDINKINAAIAGVIYLFLLSLVAIVVASLVPVYAIIIVF STAGAMFLISMLAGLLFNVDPGSHRFIIMMTLTGLALVIIVNAALMSERPIWIISCLMI VLWSGIISHGRNKLLELAGKCHSEELWSPVRCAFTGALTLYYYFIGFFGILAAIAITLV WQRHTRFFH) reveals characteristic patterns of hydrophobic residues interspersed with charged amino acids typical of membrane proteins . Computational topology prediction suggests the protein may have 6-7 transmembrane domains with both N and C termini likely located in different cellular compartments.

How can I conduct preliminary sequence analysis to predict ybhM function?

To predict ybhM function through sequence analysis:

• Perform homology searches using tools like BLAST, HHpred, or HMMer against protein databases

• Apply profile-based sequence search methods using Hidden Markov Models (HMMs) for detecting distant relationships

• Identify conserved domains using CDD, Pfam, or InterPro

• Conduct multiple sequence alignments with related proteins

• Use fold recognition methods to predict structural similarities with characterized proteins

• Apply artificial sequence design approaches to create "linker" sequences that can bridge distantly related proteins

This combinatorial approach can reveal evolutionary relationships that suggest potential functions even when direct homology is not apparent.

What are the optimal conditions for expressing recombinant ybhM in E. coli?

For optimal expression of recombinant ybhM in E. coli:

• Signal peptide selection: Test multiple signal peptides (DsbA, Hbp, OmpA, and PhoA) to identify optimal periplasmic targeting, as the choice significantly impacts yield

• Induction protocol: Implement a tunable expression system using rhamnose or similar inducers, with concentration optimization (typically lower concentrations yield better results for membrane proteins)

• Host strain selection: Use specialized strains like E. coli BL21(DE3), C41(DE3), or C43(DE3) that are optimized for membrane protein expression

• Temperature: Lower expression temperatures (16-25°C) often improve proper folding

• Media formulation: Enriched media containing phosphate buffers and supplementary amino acids can enhance expression

• Timing: Harvesting at 16 hours post-induction has shown optimal results for similar membrane proteins

How can I optimize purification of His-tagged ybhM protein while maintaining its native conformation?

For optimal purification of His-tagged ybhM:

• Cell lysis optimization:

  • For membrane proteins, use gentle extraction with detergents like DDM, LMNG, or FC-12

  • Test detergent screening to identify optimal solubilization conditions

• Purification protocol:

  • Employ immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

  • Use gradient elution with imidazole (20-300 mM)

  • Include detergents above critical micelle concentration throughout purification

• Buffer optimization:

  • Maintain pH between 7.0-8.0 (typically 50 mM Tris or phosphate buffer)

  • Include stabilizing agents (e.g., glycerol 10-15%)

  • Add reducing agents (1-5 mM DTT or TCEP) if cysteine residues are present

• Quality assessment:

  • Verify purity by SDS-PAGE

  • Confirm identity with western blotting using anti-His antibodies

  • Validate native conformation using size exclusion chromatography

Reconstitution in appropriate lipid environments may be necessary to maintain native structure for functional studies .

What approaches can enhance recombinant ybhM yield in the E. coli periplasm?

To enhance ybhM yield in the periplasm:

• Combinatorial signal peptide screening: Test multiple signal peptides (e.g., DsbA, Hbp, OmpA, PhoA) in parallel with varying production rates to identify optimal targeting efficiency

• Induction optimization:

  • Implement tunable promoters (e.g., rhamnose-inducible systems)

  • Test various inducer concentrations, with lower concentrations often yielding better results for membrane proteins

  • Optimize induction timing and duration (16 hours post-induction showed optimal results in related studies)

• Co-expression strategies:

  • Co-express chaperones (e.g., Skp, SurA, or FkpA) to assist membrane protein folding

  • Include components of the Dsb system to facilitate proper disulfide bond formation if relevant

• Host strain engineering:

  • Use strains with enhanced membrane protein expression capabilities

  • Consider deletion of specific proteases that might degrade the target protein

• Process optimization:

  • Lower cultivation temperature (16-25°C) during expression phase

  • Supplementation with specific membrane components or lipids

This combinatorial approach can significantly improve both the quantity and quality of the expressed membrane protein .

How can I determine the membrane topology of ybhM?

To determine ybhM membrane topology:

• Computational predictions:

  • Use multiple topology prediction tools (TMHMM, TOPCONS, CCTOP)

  • Generate consensus topology models

• Biochemical approaches:

  • Substituted cysteine accessibility method (SCAM):

    • Introduce cysteine residues at predicted loop regions

    • Test accessibility to membrane-impermeable sulfhydryl reagents

  • Protease protection assays:

    • Create right-side-out and inside-out membrane vesicles

    • Determine protease-accessible regions

• Reporter fusion techniques:

  • PhoA/LacZ fusion analysis:

    • Create fusions at various positions

    • Measure reporter activity to determine cytoplasmic or periplasmic localization

  • GFP sandwich technique:

    • Insert GFP between domains

    • Monitor fluorescence to determine protein topology

• Epitope tagging:

  • Insert small epitope tags at predicted loop regions

  • Perform immunofluorescence to determine accessibility

• Cryo-electron microscopy:

  • For higher resolution structural analysis

  • May require protein stabilization in nanodiscs or amphipols

A combination of these approaches provides the most reliable topology model for further functional studies.

What advanced structural biology techniques are most suitable for characterizing the three-dimensional structure of ybhM?

For characterizing ybhM's 3D structure:

Current advances in cryo-EM and AI-assisted modeling make these particularly promising for membrane proteins like ybhM that have been historically challenging to characterize structurally.

How can AI-assisted structural proteomics help in understanding ybhM function?

AI-assisted structural proteomics can elucidate ybhM function through:

• Structure prediction and analysis:

  • Generate high-confidence 3D models using AlphaFold2 or RoseTTAFold

  • Identify potential binding pockets or active sites

  • Compare with known structural folds to infer function

• Protein-protein interaction prediction:

  • Use AlphaFold-Multimer or similar tools to model potential interaction partners

  • Prioritize predicted interactions for experimental validation

  • Generate structural hypotheses about interaction interfaces

• Integration with experimental data:

  • Combine AI predictions with in-cell crosslinking mass spectrometry data

  • Validate models using co-fractionation mass spectrometry

  • Refine structures based on experimental constraints

• Functional annotation:

  • Map conserved residues onto predicted structures

  • Identify structural similarities with characterized proteins

  • Generate testable hypotheses about molecular function

• Network analysis:

  • Place ybhM in the context of the E. coli interactome

  • Predict functional relationships based on network proximity

  • Identify potential biological pathways involving ybhM

This approach has successfully identified functions for previously uncharacterized proteins, such as YneR (renamed PdhI) as an inhibitor of pyruvate dehydrogenase , and could similarly elucidate ybhM's function.

What experimental approaches can determine the biological function of ybhM?

To determine ybhM biological function:

• Genetic approaches:

  • Gene deletion (knockout) and phenotypic analysis

  • Complementation studies to confirm phenotypes

  • Conditional expression systems to study essential functions

  • Synthetic genetic array analysis to identify genetic interactions

• Transcriptomic and proteomic analyses:

  • RNA-Seq of knockout vs. wild-type strains

  • Quantitative proteomics to identify perturbed pathways

  • Phosphoproteomics or other PTM analyses if relevant

• Biochemical assays:

  • Based on predicted function (e.g., transport assays, enzymatic activity tests)

  • In vitro reconstitution in liposomes for membrane proteins

  • Substrate screening based on structural predictions

• Localization studies:

  • GFP fusion protein localization

  • Immunolocalization in fixed cells

  • Co-localization with known marker proteins

• Physiological characterization:

  • Growth under various stress conditions

  • Metabolite profiling of knockout strains

  • Microfluidic single-cell analysis of gene expression

• Evolutionary approaches:

  • Comparative genomics to identify conserved gene neighborhoods

  • Phylogenetic profiling to identify co-evolved genes

  • Systematic exploration of cross-species complementation

A combination of these approaches provides multiple lines of evidence for functional assignment .

How can I design a systematic screen to identify potential substrates or binding partners of ybhM?

To systematically screen for ybhM substrates or binding partners:

• Protein-protein interaction screens:

  • Yeast two-hybrid (Y2H) screening:

    • Library-based approach using E. coli genomic fragments as prey

    • Matrix-based approach testing specific candidate interactions

  • Pull-down assays with immobilized His-tagged ybhM

  • Co-immunoprecipitation with antibodies against ybhM or its tag

  • Crosslinking mass spectrometry to identify proximal proteins in vivo

  • Bacterial two-hybrid systems optimized for membrane proteins

• Substrate transport/binding assays:

  • Reconstitution in proteoliposomes with fluorescent substrate analogs

  • Isothermal titration calorimetry with candidate substrates

  • Surface plasmon resonance to measure binding kinetics

  • Differential scanning fluorimetry to identify stabilizing ligands

  • Radioligand binding assays with potential substrates

• Genetic approaches:

  • Multicopy suppressor screening of ybhM deletion phenotypes

  • Chemical genetic profiling against compound libraries

  • Transposon mutagenesis screens in ybhM deletion background

• Computational approaches:

  • Molecular docking of metabolite libraries

  • Virtual screening based on binding pocket analysis

  • Co-evolution analysis to identify functionally linked proteins

Integration of multiple screening approaches provides higher confidence in identifying true interaction partners or substrates.

How can transcriptomic and proteomic approaches help characterize the function of ybhM?

Transcriptomic and proteomic approaches for ybhM characterization:

• Comparative transcriptomics:

  • RNA-Seq analysis comparing ybhM knockout vs. wild-type under various conditions

  • Time-course expression analysis during environmental transitions

  • ChIP-exo screening if ybhM might function as a transcription factor

  • Ribosome profiling to assess translational effects

• Differential proteomics:

  • Quantitative proteomics (TMT or SILAC) comparing ybhM knockout to wild-type

  • Secretome analysis to identify periplasmic/extracellular protein changes

  • Membrane proteome analysis focusing on membrane protein abundance changes

  • Post-translational modification profiling (phosphorylation, acetylation)

• Protein complex analysis:

  • Blue native PAGE to identify native complexes containing ybhM

  • Size exclusion chromatography combined with mass spectrometry (SEC-MS)

  • Co-fractionation mass spectrometry to identify stable complexes

  • Crosslinking mass spectrometry for transient interactions in vivo

• Data integration and analysis:

  • Pathway enrichment analysis of differentially expressed genes/proteins

  • Network analysis to identify perturbed functional modules

  • Multi-omics data integration combining transcriptomic, proteomic, and metabolomic datasets

  • Comparative analysis across multiple stress conditions

These approaches can reveal pathways affected by ybhM deletion or overexpression, providing insights into its cellular function .

What methods are most appropriate for identifying membrane protein interactions involving ybhM?

For identifying membrane protein interactions with ybhM:

• In vivo crosslinking approaches:

  • Membrane-permeable crosslinkers (DSP, DSSO) to stabilize transient interactions

  • Photo-crosslinking with genetically incorporated unnatural amino acids

  • Proximity labeling using BioID or APEX2 fused to ybhM

  • Crosslinking mass spectrometry to identify interaction sites

• Genetic interaction methods:

  • Modified bacterial two-hybrid systems optimized for membrane proteins

  • Split-protein complementation assays (e.g., split-GFP, DHFR)

  • Synthetic genetic arrays to identify genes with functional relationships

• Co-purification strategies:

  • Tandem affinity purification adapted for membrane proteins

  • Co-immunoprecipitation with mild detergents

  • Blue native PAGE to preserve native complexes

  • Co-fractionation profiling across different conditions

• Biophysical approaches:

  • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

  • Bioluminescence resonance energy transfer (BRET)

  • Surface plasmon resonance with purified components

  • Microscale thermophoresis to measure binding affinities

• Structural approaches:

  • Cryo-electron microscopy of purified complexes

  • Cross-linking coupled with mass spectrometry to map interaction interfaces

  • Hydrogen-deuterium exchange to identify protected regions

Combining multiple orthogonal approaches provides higher confidence in identifying true interaction partners of membrane proteins like ybhM .

How can I validate potential protein-protein interactions identified for ybhM?

To validate ybhM protein-protein interactions:

• Reciprocal co-purification experiments:

  • Pull-down tagged ybhM and confirm presence of partner

  • Pull-down tagged partner and confirm presence of ybhM

  • Quantify stoichiometry of the interaction

• Mutagenesis approaches:

  • Identify and mutate key residues at predicted interaction interface

  • Perform site-directed mutagenesis of conserved residues

  • Create deletion constructs to map interaction domains

• In vitro binding assays:

  • Measure direct binding with purified components using:

    • Surface plasmon resonance (quantitative KD determination)

    • Isothermal titration calorimetry (thermodynamic parameters)

    • Microscale thermophoresis (solution-based measurement)

• Cellular validation:

  • Co-localization of fluorescently tagged proteins

  • FRET/BRET analysis in living cells

  • BiFC (Bimolecular Fluorescence Complementation)

  • PLA (Proximity Ligation Assay) in fixed cells

• Functional validation:

  • Phenotypic analysis of double knockouts

  • Suppressor analysis (overexpression of one partner rescuing other's deletion)

  • Identification of shared phenotypes between partner mutations

  • Correlation of expression patterns across conditions

• Structural validation:

  • Crosslinking mass spectrometry to map interaction interfaces

  • Co-crystallization or cryo-EM of the complex

  • Hydrogen-deuterium exchange to identify protected regions

Applying multiple orthogonal validation approaches provides strong evidence for genuine interactions and eliminates false positives .

How can integrative approaches help understand the role of ybhM in cellular protein networks?

Integrative approaches to understand ybhM in protein networks:

• Multi-omics data integration:

  • Combine protein-protein interaction data with:

    • Transcriptomic co-expression patterns

    • Metabolomics profiles of knockout strains

    • Phenotypic screening results

  • Use machine learning to identify significant correlations across datasets

• Network analysis approaches:

  • Map ybhM into protein interaction networks

  • Identify network motifs and modules containing ybhM

  • Calculate centrality measures to assess network importance

  • Perform topological analysis to identify functional clusters

• Evolutionary systems biology:

  • Analyze co-evolution patterns of ybhM and partners

  • Conduct phylogenetic profiling to identify functionally related proteins

  • Examine gene neighborhood conservation across species

  • Study selective pressure patterns on interaction interfaces

• Spatial organization analysis:

  • Super-resolution microscopy to determine co-localization patterns

  • Organelle proteomics to confirm subcellular localization

  • In-cell crosslinking to capture spatial relationships

  • Membrane microdomain analysis if applicable

• Temporal dynamics assessment:

  • Study interaction changes during stress responses

  • Monitor complex formation across growth phases

  • Analyze post-translational modifications affecting interactions

  • Examine changes in response to environmental perturbations

• Computational modeling:

  • Constraint-based modeling incorporating ybhM interactions

  • Kinetic modeling of processes involving ybhM

  • Machine learning to predict functional impact of interactions

  • Integration with whole-cell models of E. coli

These integrative approaches can reveal emergent properties not apparent from individual experiments and position ybhM within functional cellular networks .

How might understanding ybhM function contribute to broader research in bacterial membrane biology?

Understanding ybhM could advance bacterial membrane biology by:

• Expanding membrane proteome characterization:

  • Assigning function to a currently uncharacterized membrane protein

  • Potentially revealing novel transport mechanisms or regulatory pathways

  • Contributing to complete functional annotation of the E. coli genome

• Membrane transport insights:

  • If ybhM functions as a transporter, it could reveal new substrate specificities

  • Understanding of structural determinants for substrate recognition

  • Potential identification of novel transport mechanisms

• Bacterial stress response mechanisms:

  • Possible role in membrane integrity during environmental stresses

  • Contribution to envelope stress response pathways

  • Potential involvement in antibiotic resistance mechanisms

• Methodological advances:

  • Refinement of techniques for membrane protein characterization

  • Development of improved expression and purification protocols

  • Validation of AI-based structure prediction for membrane proteins

• Evolutionary perspectives:

  • Conservation patterns across bacterial species

  • Understanding selective pressures on membrane protein evolution

  • Possible identification of species-specific adaptations

• Biotechnological applications:

  • Potential development as an expression tag for membrane protein production

  • Possible engineering for biosensor applications if substrate is identified

  • Understanding for engineered transport pathways in synthetic biology

Characterizing ybhM would contribute to the broader goal of complete functional annotation of bacterial genomes and membrane proteomes.

How can experimental findings from ybhM studies be integrated with computational approaches to improve functional prediction of other uncharacterized proteins?

Integrating ybhM findings with computational approaches:

• Improved homology detection algorithms:

  • Use validated ybhM structure-function relationships to refine sequence profiles

  • Develop more sensitive Hidden Markov Models (HMMs) for detecting remote homologs

  • Create artificial "linker" sequences between distantly related proteins

• Machine learning applications:

  • Train models using ybhM experimental data to predict functions of other uncharacterized proteins

  • Develop feature vectors incorporating multiple data types (sequence, structure, interaction)

  • Create neural network architectures optimized for membrane protein function prediction

• Network-based inference:

  • Apply "guilt by association" principles across protein interaction networks

  • Use ybhM interactions to inform functional predictions for partners

  • Develop network propagation algorithms to extend functional assignments

• Integrative functional annotation pipelines:

  • Combine multiple lines of evidence (structural, genetic, biochemical)

  • Weight evidence based on validation rates from ybhM studies

  • Develop consensus scoring systems for functional predictions

• Structural proteomics integration:

  • Use experimental ybhM structures to validate and refine AI prediction methods

  • Develop targeted approaches for structural characterization of similar proteins

  • Create comparative modeling pipelines optimized for membrane proteins

• Standardized validation frameworks:

  • Establish benchmarks for computational predictions based on experimental validation

  • Develop metrics for assessing confidence in functional predictions

  • Create community resources for sharing annotation data

This integration would establish a virtuous cycle where experimental data improves computational predictions, which in turn guide more targeted experiments for other uncharacterized proteins .

What are the challenges and limitations in current approaches to characterizing uncharacterized proteins like ybhM?

Challenges and limitations in characterizing proteins like ybhM:

• Technical challenges in membrane protein biology:

  • Difficulties in heterologous expression and purification

  • Challenges in maintaining native conformation during extraction

  • Limited yield compared to soluble proteins

  • Requirement for detergents or membrane mimetics for stability

• Functional assignment limitations:

  • Lack of obvious homology to characterized proteins

  • Possible novel or moonlighting functions not predicted by sequence

  • Redundancy in bacterial genomes masking phenotypes

  • Context-dependent functions only expressed under specific conditions

• Experimental design constraints:

  • Difficulty in designing targeted assays without functional hints

  • Need for broad screening approaches that may miss specific activities

  • Challenge of reconstituting proper membrane environment for functional assays

  • Limited throughput of membrane protein characterization techniques

• Computational prediction limitations:

  • Lower accuracy of structure prediction for membrane proteins

  • Challenges in modeling membrane protein dynamics

  • Difficulty in predicting protein-lipid interactions

  • Limited training data for machine learning approaches on membrane proteins

• Data integration challenges:

  • Reconciling contradictory results from different methods

  • Determining causality versus correlation in omics data

  • Standardizing data from diverse experimental platforms

  • Quantifying confidence in functional predictions

• Resource and prioritization issues:

  • Limited resources for characterizing all uncharacterized proteins

  • Difficulty in selecting high-priority targets for detailed study

  • Challenges in publishing characterization of proteins with subtle phenotypes

  • Tendency to focus on proteins with clear phenotypes or applications