Recombinant Escherichia coli Uncharacterized protein yfhR (yfhR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
yfhR; b2534; JW2518; Uncharacterized protein YfhR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yfhR
Target Protein Sequence
MALPVNKRVPKILFILFVVAFCVYLVPRVAINFFYYPDDKIYGPDPWSAESVEFTAKDGT RLQGWFIPSSTGPADNAIATIIHAHGNAGNMSAHWPLVSWLPERNFNVFMFDYRGFGKSK GTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANILDVIGRGDREGIRAVILD STFASYATIANQMIPGSGYLLDESYSGENYIASVSPIPLLLIHGKADHVIPWQHSEKLYS LAKEPKRLILIPDGEHIDAFSDRHGDVYREQMVDFILSALNPQN
Uniprot No.

Target Background

Database Links
Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are optimal for recombinant production of yfhR protein?

For laboratory-scale production of recombinant yfhR protein, E. coli remains the expression system of choice due to its rapid growth, high yields, and well-established genetic tools . The most effective expression systems for yfhR utilize pET-based vectors with T7 RNA polymerase-driven expression, as this provides tight regulation and high expression levels upon induction .

The optimal conditions for yfhR expression include:

ParameterOptimal ConditionNotes
Expression strainBL21(DE3) or derivativesStrains lacking lon and ompT proteases reduce degradation
Growth temperature16-25°C post-inductionLower temperatures reduce inclusion body formation
Induction OD6000.6-0.8Mid-log phase provides balance of biomass and expression capacity
IPTG concentration0.1-0.5 mMLower concentrations reduce metabolic burden
Expression time12-18 hoursExtended expression at lower temperatures improves folding

Since the yfhR protein contains hydrophobic regions, specialized E. coli strains engineered for membrane protein expression (such as C41/C43 derivatives) may provide better results if standard BL21 strains yield poor soluble expression . The protein is typically expressed with an N-terminal His-tag to facilitate purification, though the tag location may need optimization if it affects protein folding or function .

How can researchers effectively purify recombinant yfhR protein while maintaining its native structure?

Purification of recombinant His-tagged yfhR requires careful consideration of the protein's potential membrane association and structural stability. A methodological approach involves:

  • Cell Lysis: Gentle lysis using mild detergents (0.5-1% Triton X-100 or n-dodecyl β-D-maltoside) is recommended to solubilize potential membrane-associated fractions without denaturing the protein .

  • Immobilized Metal Affinity Chromatography (IMAC): The His-tagged protein can be purified using Ni-NTA or similar matrices. A stepwise purification protocol includes:

    • Equilibration of the column with buffer containing 20-50 mM imidazole to reduce non-specific binding

    • Washing with increasing imidazole concentrations (50-100 mM)

    • Elution with 250-300 mM imidazole buffer

  • Buffer Optimization: The stability of yfhR can be enhanced by including glycerol (10-15%) and reducing agents like DTT (1-5 mM) in purification buffers if the protein contains cysteine residues .

  • Secondary Purification: Size exclusion chromatography as a polishing step separates aggregates and precisely determines the oligomeric state of yfhR in solution.

Once purified, protein stability can be maintained by adding 6% trehalose to the storage buffer and aliquoting the protein for storage at -80°C to prevent freeze-thaw cycles . The purity should be validated by SDS-PAGE (expected >90%), and functional assays should be developed to assess whether the purified protein retains its native activity .

What approaches can resolve contradictory experimental data when characterizing the yfhR protein's function?

When researchers encounter contradictory data during yfhR functional characterization, a systematic approach is necessary to resolve discrepancies:

  • Metadata Analysis: Catalog all experimental conditions across contradictory studies, including expression constructs, purification methods, buffer compositions, and analytical techniques. Often contradictions arise from subtle methodological differences .

  • Validation Through Multiple Techniques: Apply orthogonal techniques to cross-validate observations. For example, if structural predictions conflict, combine circular dichroism, limited proteolysis, and thermal shift assays to reach consensus on protein folding and stability .

  • Domain-Specific Testing: Based on sequence analysis, the yfhR protein may contain hydrolase domains. Test enzymatic activity using a panel of potential substrates under varying conditions (pH, temperature, cofactors) to definitively establish substrate specificity .

  • Post-Translational Modification Analysis: Recent advances in E. coli glycosylation pathway engineering suggest potential for glycosylation of certain proteins. If contradictory function data exists, investigate whether post-translational modifications affect yfhR activity using mass spectrometry .

  • Data Contradiction Resolution Framework:

Contradiction TypeResolution ApproachAnalytical Method
Self-contradictory resultsControl for variables in expression/purificationSystematic parameter variation with statistical analysis
Contradicting study pairsReplicate both methodologies in parallelBlind testing by independent researchers
Conditional contradictionsIdentify environmental or cellular factors causing variabilityHigh-throughput condition screening

The contextual analysis of contradictory data should also consider the metabolic burden on host cells during expression, as this can significantly alter protein quality and experimental outcomes . The development of machine learning approaches to predict optimal conditions may also help resolve contradictions by identifying patterns in successful versus unsuccessful expression attempts .

How does the metabolic burden of yfhR overexpression affect E. coli host physiology and experimental reproducibility?

The metabolic burden imposed by yfhR overexpression represents a critical yet often overlooked factor affecting experimental reproducibility. Recent studies indicate that recombinant protein production creates complex metabolic consequences:

Overexpression of yfhR protein redirects cellular resources away from host metabolism, creating several quantifiable effects:

  • Growth Rate Reduction: Typically 30-50% decrease in growth rate occurs when yfhR expression is induced with standard IPTG concentrations (0.5-1.0 mM) .

  • Energy Metabolism Shift: ATP production pathways are redirected, with increased glucose consumption but reduced biomass yield, as energy is diverted to heterologous protein synthesis .

  • Stress Response Activation: Heat shock proteins (DnaK, GroEL) are upregulated 2-5 fold, potentially interfering with yfhR folding and compromising experimental consistency .

  • Translational Competition: Rare codons in the yfhR sequence can deplete specific tRNA pools, affecting both host and recombinant protein synthesis rates .

To mitigate these effects and improve reproducibility, researchers should:

  • Implement auto-induction media systems that maintain balanced growth while gradually inducing expression

  • Reduce cultivation temperature to 16-25°C post-induction to minimize stress responses

  • Consider codon optimization of the yfhR gene for E. coli expression

  • Monitor plasmid stability throughout expression, as metabolic burden increases plasmid loss rate

The metabolic burden effects can be quantified through growth curve analysis, metabolite profiling, and proteome analysis of host cells. These measurements should be standardized across laboratories to facilitate more reproducible yfhR research .

What strategies can improve the formation of disulfide bonds in yfhR protein when expressed in E. coli?

Improving disulfide bond formation for yfhR protein requires targeted strategies that address the reducing cytoplasmic environment of standard E. coli strains. Based on the amino acid sequence analysis, yfhR contains multiple cysteine residues that may form structural disulfide bonds essential for proper folding and function .

Genetic Engineering Approaches:

  • Specialized E. coli Strains: Utilizing strains engineered for enhanced disulfide bond formation provides significant advantages:

    • SHuffle® strains constitutively express cytoplasmic DsbC (disulfide bond isomerase)

    • Origami™ or BL21(DE3)pLysS strains with mutations in thioredoxin reductase (trxB) and glutathione reductase (gor) genes create an oxidizing cytoplasm

  • Co-expression Systems: Implementing helper proteins dramatically improves correct disulfide formation:

    • DsbA and DsbC co-expression enhances both formation and isomerization of disulfide bonds

    • Sulfhydryl oxidase (Erv1p) from yeast can be co-expressed to actively catalyze disulfide bond formation

Process Optimization Strategies:

ParameterConventional ApproachOptimized ApproachImprovement Factor
Media compositionStandard LBMOPS minimal media with glucose2-3x higher correctly folded protein
Oxygen transferStandard shakingEnhanced aeration with baffled flasks30-50% increase in disulfide formation
Redox buffersNone0.1-1.0 mM oxidized/reduced glutathione pairs2x improved correct disulfide pairing
Temperature37°C16-20°C3-4x reduction in misfolded aggregates

When expressing yfhR with complex disulfide patterns, a sequential refolding approach may be necessary where the protein is first expressed as inclusion bodies, then solubilized in denaturing conditions, and finally refolded using a glutathione redox buffer system with gradually decreasing denaturant concentration . This approach allows greater control over the disulfide formation process but requires extensive optimization for each protein construct.

How can researchers determine the three-dimensional structure of yfhR protein when crystallization proves challenging?

When crystallization of yfhR proves challenging, researchers should implement alternative structural biology approaches to elucidate its three-dimensional conformation:

When pursuing these alternative approaches, it's essential to validate the resulting structures against biochemical and functional data to ensure biological relevance. The combination of computational prediction with experimental validation has proven particularly effective for uncharacterized proteins like yfhR .

How can evolutionary approaches like those used in the E. coli Long-Term Evolution Experiment be applied to study yfhR function?

The Long-Term Evolution Experiment (LTEE) methodology offers powerful approaches for elucidating the function of uncharacterized proteins like yfhR through evolutionary pressures and adaptation:

  • Knockout-Complementation Evolution: By creating yfhR knockout strains and subjecting them to long-term evolution under varying selective pressures, researchers can identify conditions where yfhR provides fitness advantages . The experiment should include:

    • Parallel evolution of wild-type and ΔyfhR strains across multiple environmental conditions

    • Regular sampling and whole-genome sequencing to identify compensatory mutations

    • Fitness assays comparing evolved populations to detect environment-specific defects

  • Gain-of-Function Selection: The LTEE approach demonstrated that E. coli can evolve new functions, such as aerobic citrate utilization after approximately 31,000 generations . For yfhR functional characterization:

    • Subject E. coli strains overexpressing yfhR to selection in environments requiring novel metabolic activities

    • Design selective media that might reveal hidden enzymatic capabilities of yfhR

    • Monitor for phenotypic changes that correlate with yfhR expression levels

  • Experimental Evolution Data Analysis:

Evolutionary ApproachTimeframeExpected OutcomesAnalysis Methods
Short-term selection100-500 generationsRegulatory adaptations affecting yfhR expressionRNA-seq, proteomics, fitness assays
Medium-term evolution1,000-5,000 generationsFunctional mutations in yfhR or interacting partnersComparative genomics, mutation rate analysis
Long-term evolution>10,000 generationsPotential neofunctionalization or pathway integrationSystems biology, metabolic flux analysis, epistasis mapping
  • Frozen Fossil Record Approach: Following the LTEE methodology, researchers should maintain a frozen "fossil record" of evolving populations, allowing retrospective analysis of when and how functional changes emerged . This resource becomes invaluable for understanding the stepwise acquisition of mutations that reveal yfhR's role.

The evolutionary approach is particularly valuable for uncharacterized proteins like yfhR because it allows the protein's function to emerge through natural selection rather than requiring a priori hypotheses about its activity . When combined with modern omics technologies, this approach can reveal not just the function of yfhR, but also its integration within cellular networks.

What are the implications of NIH guidelines for research involving recombinant yfhR protein expression systems?

Research involving recombinant yfhR expression must adhere to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, with specific implications for experimental design and safety protocols:

Expression SystemNIH Guideline SectionOversight RequirementsAdditional Documentation
Standard E. coli lab strainsIII-FIBC notificationRisk assessment form
Mammalian cell expressionIII-D-1IBC approval requiredDetailed safety protocols
Plant or animal expressionIII-D-4IBC approval with possible RAC reviewContainment description
Gene editing of yfhRIII-A or III-BIBC approval, possible RAC reviewComprehensive risk assessment
  • Safety Monitoring and Reporting:

    • Any unexpected outcomes or adverse events during yfhR research must be reported to the IBC

    • Significant changes to approved protocols require amendment submissions

    • Annual updates on ongoing research are typically required

For international collaborations involving yfhR expression systems, researchers must ensure compliance with both NIH Guidelines and local regulatory frameworks, which may have additional requirements . Additionally, proper documentation of safety procedures and training records must be maintained throughout the research project, especially if the function of yfhR is determined to have implications for pathogenicity or environmental impact.

What emerging artificial intelligence approaches could accelerate functional characterization of uncharacterized proteins like yfhR?

Recent advances in artificial intelligence offer promising approaches to accelerate the functional characterization of uncharacterized proteins like yfhR:

  • Structure Prediction and Functional Inference:

    • Deep learning models like AlphaFold2 can predict protein structures with near-experimental accuracy

    • Structure-based function prediction algorithms then identify potential active sites and binding pockets

    • For yfhR specifically, structural predictions could reveal enzyme active site geometries suggesting specific catalytic activities

  • Interaction Network Prediction:

    • Graph neural networks can predict protein-protein interaction networks

    • These predictions guide targeted experimental validation of yfhR binding partners

    • Contextual embedding models integrate multiple data types (genomic context, co-expression, phylogenetic profiles) to place yfhR in biological pathways

  • Machine Learning for Experimental Design Optimization:

    • Reinforcement learning algorithms can optimize expression conditions through iterative experimentation

    • Bayesian optimization approaches reduce the experimental space needed to identify optimal solubility and activity conditions

    • Active learning frameworks guide researchers to the most informative next experiments for yfhR characterization

  • Contradiction Resolution Through Data Integration:

    • Natural language processing of scientific literature can identify conflicting reports about yfhR homologs

    • Multi-modal AI systems can integrate experimental data across different studies to resolve contradictions

    • Explainable AI approaches help researchers understand the basis for functional predictions

The implementation of these AI approaches requires systematic data collection and experimental validation:

AI ApproachRequired Data TypesValidation StrategyExpected Outcome
Structure-function predictionSequence data, homology informationMutational analysis of predicted active sitesEnzymatic activity hypotheses
Interaction network analysisProteomics data, genomic contextCo-immunoprecipitation, bacterial two-hybridBiological pathway assignment
Experimental design optimizationExpression condition outcomesIterative testing of AI-suggested conditionsOptimal expression protocol
Literature-based discoveryPublished research on homologous proteinsTargeted experiments to resolve contradictionsConsensus function model

Despite these advances, researchers must recognize that AI predictions require experimental validation, as current models may not fully account for post-translational modifications, conformational dynamics, or condition-specific behaviors of proteins like yfhR . The most effective approach combines AI predictions with systematic experimental testing in an iterative cycle.

What strategies can resolve inclusion body formation when expressing recombinant yfhR protein?

Inclusion body formation is a common challenge when expressing recombinant yfhR protein. A methodical approach to resolving this issue involves:

  • Expression Condition Optimization:

    • Temperature reduction to 16-20°C after induction dramatically slows protein synthesis, allowing more time for proper folding

    • Decreasing inducer concentration (0.01-0.1 mM IPTG) reduces expression rate

    • Using auto-induction media provides gradual protein expression, reducing aggregation

  • Genetic Engineering Solutions:

    • Co-expression of molecular chaperones (GroEL/ES, DnaK/J) enhances folding capacity

    • Fusion partners that increase solubility (MBP, SUMO, thioredoxin) can be added with appropriate protease cleavage sites

    • Codon optimization to reduce ribosomal pausing at rare codons

  • Inclusion Body Recovery and Refolding:
    When soluble expression remains challenging, inclusion bodies can be processed:

Refolding StageMethodCritical ParametersSuccess Indicators
IsolationGentle lysis and low-speed centrifugationDetergent concentration, wash buffers>90% purity of inclusion bodies
Solubilization6-8M urea or guanidine HClpH, reducing agents, protein concentrationComplete solubilization without aggregation
RefoldingDialysis or dilutionRedox conditions, additives (L-arginine, glycerol)Minimal precipitation during refolding
PurificationSize exclusion chromatographyBuffer composition, flow rateMonodisperse peak separation
  • Analytical Quality Assessment:

    • Circular dichroism to confirm secondary structure formation

    • Thermal shift assays to assess stability of refolded protein

    • Activity assays tailored to predicted function to verify proper folding

For yfhR specifically, which contains hydrophobic regions based on sequence analysis, the addition of mild detergents (0.05% n-dodecyl β-D-maltoside) to lysis and purification buffers may maintain solubility without denaturation . Additionally, expression as a secreted protein using appropriate signal sequences can bypass cytoplasmic aggregation issues by directing the protein to the periplasmic space where oxidizing conditions facilitate proper folding .

How can researchers validate that recombinantly expressed yfhR protein maintains its native conformation and activity?

Validating the native conformation and activity of recombinantly expressed yfhR requires a multi-faceted approach, especially challenging for uncharacterized proteins where the natural function remains unclear:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Intrinsic fluorescence spectroscopy to assess tertiary folding through tryptophan emissions

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Thermal and Chemical Stability Analysis:

    • Differential scanning calorimetry (DSC) to determine melting temperature (Tm)

    • Chemical denaturation curves using guanidine hydrochloride to assess conformational stability

    • Limited proteolysis to identify stable domains resistant to digestion

  • Functional Activity Screening:
    For uncharacterized proteins like yfhR, a systematic approach to identifying function includes:

Activity ClassScreening MethodDetection SystemControls
Hydrolase activitySubstrate panel testingColorimetric/fluorescent assaysCommercial enzymes
Binding activityThermal shift assays with potential ligandsFluorescent dye (SYPRO Orange)Known binding pairs
Enzymatic activityCoupled enzyme assaysSpectrophotometric detectionEnzyme-free reactions
Structural roleIn vivo complementation of knockoutGrowth/phenotype assessmentEmpty vector controls
  • Comparative Analysis with Native Protein:

    • When possible, compare recombinant yfhR with the native protein isolated from E. coli

    • Analyze post-translational modifications using mass spectrometry

    • Compare kinetic parameters if enzymatic activity is identified

The validation process should include negative controls (denatured protein samples) and positive controls (proteins with known functions similar to predicted yfhR function) . Additionally, since yfhR is uncharacterized, researchers should consider systems biology approaches like analyzing growth phenotypes of overexpression or knockout strains under various conditions to gain insights into its physiological role.

What are the most promising research directions for fully characterizing the structure and function of yfhR protein?

The comprehensive characterization of yfhR represents an exciting frontier in E. coli proteomics research, with several promising directions for future investigation:

  • Integrated Multi-Omics Approaches:

    • Combining transcriptomics, proteomics, and metabolomics data from yfhR knockout and overexpression strains

    • Applying network analysis to identify functional pathways affected by yfhR perturbation

    • Utilizing temporal omics data to capture dynamic responses revealing yfhR's role

  • Advanced Structural Biology:

    • Pursuing hybrid approaches combining cryo-EM, NMR, and computational modeling

    • Investigating conformational dynamics through hydrogen-deuterium exchange mass spectrometry

    • Exploring protein-protein and protein-ligand interactions through crosslinking and proximity labeling

  • Synthetic Biology Applications:

    • Engineering yfhR variants with enhanced or altered functions based on structural insights

    • Developing biosensors or biocatalysts if enzymatic activity is confirmed

    • Exploring potential biotechnological applications based on discovered functions

  • Evolutionary Context Analysis:

    • Applying the methodologies of the E. coli Long-Term Evolution Experiment to understand yfhR's evolutionary constraints

    • Conducting comparative genomics across diverse bacteria to trace the protein's evolutionary history

    • Using ancestral sequence reconstruction to understand the protein's functional evolution

The future characterization of yfhR will likely depend on interdisciplinary collaboration combining traditional biochemical approaches with cutting-edge computational methods and evolutionary analyses. As recombinant protein expression technologies continue to advance, particularly in addressing challenges like disulfide bond formation and membrane protein expression, our ability to study previously uncharacterized proteins like yfhR will dramatically improve .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.