Recombinant Escherichia coli Uncharacterized protein ygaM (ygaM)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Although YgaM remains uncharacterized, indirect evidence suggests potential roles:

  • Membrane Localization: Predicted to anchor to the inner membrane via a C-terminal transmembrane helix, implicating it in membrane-associated processes .

  • Ribosome Binding: STRING database annotations propose interaction with ribosomal components, potentially influencing translation or stress responses .

  • Potassium Sensing: Homologs (e.g., YgaU) bind potassium ions, suggesting YgaM may participate in ion homeostasis .

Related proteins like YmgB (AriR) regulate biofilm formation and acid resistance in E. coli via indole signaling , while YggS modulates branched-chain amino acid metabolism . These findings hint at YgaM’s possible involvement in stress adaptation or metabolic regulation, though direct evidence is lacking.

Research Applications

Recombinant YgaM is primarily utilized as a research reagent:

  • Vaccine Development: Serves as an antigen component for studying E. coli pathogenicity .

  • ELISA and Immunoassays: Commercial kits employ purified YgaM for antibody validation .

  • Structural Studies: Crystallization efforts aim to resolve its 3D architecture, leveraging its small size (~12–14 kDa) and solubility .

Production and Quality Control

Recombinant YgaM is typically produced in E. coli expression systems with the following specifications:

  • Purity: >85–90% (verified by SDS-PAGE) .

  • Storage: Lyophilized or in Tris/PBS buffers with glycerol (≤50%) at –20°C to –80°C .

  • Limitations: Not for human or animal use; restricted to in vitro research .

Future Directions

Further studies are needed to:

  • Elucidate YgaM’s interaction partners using pull-down assays or yeast two-hybrid screens.

  • Characterize its role in potassium homeostasis or ribosomal function via knockout models.

  • Explore its utility in synthetic biology as a membrane-anchored scaffold.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ygaM; b2672; JW2647; Uncharacterized protein YgaM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ygaM
Target Protein Sequence
MGDHMFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKE TRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMRKS
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW2647

STRING: 316407.1800060

Protein Families
ElaB/YgaM/YqjD family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What are the key structural features of the YgaM protein?

YgaM belongs to a family of largely uncharacterized proteins with predicted C-terminal transmembrane domains (TM). Compared to its related proteins YqjD and ElaB, YgaM has the shortest predicted TM helix but possesses the longest C-terminal periplasmic tail . The protein contains conserved features including a tryptophan residue following a conserved proline, and an arginine-lysine motif at the C-terminus, unlike the double arginine motifs found in YqjD and ElaB . These putative interfacial residues likely stabilize a particular transmembrane orientation, which may be crucial for its function.

What methods are effective for detecting native YgaM in E. coli samples?

For detecting native YgaM, peptide antibodies specific to unique regions of the protein provide the most reliable approach, with corresponding knockout strains (ΔygaM) serving as essential negative controls . When using western blotting techniques, sample preparation should account for YgaM's membrane association, requiring specific membrane protein extraction protocols. Since YgaM abundance is generally lower than related proteins, enrichment techniques may be necessary before detection. Time course experiments analyzing protein levels at different growth phases (particularly comparing exponential and stationary phases) are recommended, as YgaM expression may be growth phase-dependent despite the inconsistent MS data.

What expression systems are most effective for recombinant YgaM production?

For recombinant YgaM expression, E. coli-based systems using vectors with inducible promoters (such as T7 or araBAD) are generally effective. The key considerations for successful expression include:

  • Using low to moderate induction levels to prevent aggregation of this membrane protein

  • Expression in E. coli strains optimized for membrane proteins (e.g., C41(DE3), C43(DE3))

  • Adding affinity tags (His-tag or FLAG-tag) at either N-terminus or after careful consideration at the C-terminus (which contains the crucial TM domain)

  • Incorporating protease cleavage sites if tag removal is desired for functional studies

  • Growth at lower temperatures (16-25°C) after induction to facilitate proper folding

The addition of affinity tags should be approached cautiously, as the C-terminal transmembrane domain is critical for YgaM's localization and potentially its function. When studying YgaM function, verification that the tagged protein retains proper membrane localization is essential.

What purification strategies yield functional YgaM protein?

Purifying YgaM requires membrane protein extraction techniques followed by standard chromatography methods. The recommended approach includes:

  • Cell lysis using methods gentle enough to preserve membrane protein structure

  • Membrane fraction isolation through differential centrifugation

  • Membrane protein solubilization using mild detergents (DDM, LDAO, or Brij-35)

  • Affinity chromatography leveraging the introduced tag (His-tag, FLAG-tag)

  • Size exclusion chromatography for further purification and buffer exchange

  • Quality assessment through SDS-PAGE, western blotting, and mass spectrometry

It's crucial to maintain detergent concentrations above critical micelle concentration throughout purification to prevent protein aggregation. Additionally, incorporating stability assays to determine optimal buffer conditions will maximize protein integrity during downstream applications.

How does YgaM compare structurally and functionally to YqjD and ElaB proteins?

The structural and functional comparison between these three related proteins reveals distinct characteristics that may indicate specialized roles:

These differences suggest potential functional divergence despite structural similarities . Experimental approaches to investigate these functional differences would include:

  • Creating single, double, and triple knockouts to assess phenotypic changes

  • Complementation studies with chimeric proteins combining domains from different proteins

  • Localization studies using fluorescent protein fusions

  • Comparative interactome analysis to identify unique binding partners

What methodologies can identify YgaM-specific functions distinct from YqjD and ElaB?

To differentiate YgaM functions from its related proteins, researchers should employ a multifaceted approach:

  • Differential phenotyping: Subject single (ΔygaM), double (ΔygaM/ΔelaB, ΔygaM/ΔyqjD), and triple (ΔygaM/ΔelaB/ΔyqjD) knockout strains to diverse stress conditions (osmotic, oxidative, pH, antimicrobial challenges)

  • Transcriptomic analysis: Perform RNA-seq on ΔygaM strains under various conditions to identify differentially expressed genes compared to controls and other related protein knockouts

  • Protein-protein interaction studies: Use techniques like BioID or APEX proximity labeling with YgaM as bait to identify specific interacting partners that differ from those of YqjD and ElaB

  • Domain swapping experiments: Create chimeric proteins where domains from YgaM are replaced with corresponding regions from YqjD or ElaB to pinpoint regions responsible for unique functions

  • Conditional expression systems: Develop strains where YgaM expression can be precisely controlled to study dose-dependent effects and temporal requirements

What evidence suggests YgaM's involvement in ribosome inactivation?

YgaM belongs to a class of widely distributed C-tail anchored proteins implicated in ribosome inactivation mechanisms . While direct evidence specifically for YgaM is limited in the provided search results, its structural similarity to proteins in this functional class suggests potential involvement. To investigate this potential role, researchers should:

  • Perform in vitro translation assays comparing translation efficiency in the presence and absence of purified YgaM

  • Conduct ribosome binding assays to assess direct interaction between YgaM and ribosomal components

  • Use ribosome profiling to detect changes in translation patterns when YgaM is overexpressed or deleted

  • Employ cryo-EM to visualize potential YgaM-ribosome complexes

  • Perform polysome profiling to assess changes in polysome distribution in response to YgaM expression levels

How can researchers experimentally determine YgaM's specific mechanism of action on ribosomes?

If YgaM indeed functions in ribosome inactivation, characterizing its specific mechanism requires:

  • Site-directed mutagenesis: Systematically mutate conserved residues (particularly in the C-terminal domain) to identify those critical for ribosome interaction and inactivation

  • Cross-linking mass spectrometry: Use chemical cross-linkers followed by mass spectrometry to map the exact contact points between YgaM and ribosomal components

  • In vitro reconstitution: Reconstitute translation systems with purified components to determine which specific step of translation is affected by YgaM

  • Real-time kinetic measurements: Monitor translation processes in real-time using fluorescence-based assays to determine the kinetics of YgaM-mediated inhibition

  • Structural biology approaches: Determine high-resolution structures of YgaM-ribosome complexes using cryo-EM or X-ray crystallography to visualize the molecular basis of interaction

Could YgaM be subject to O-linked glycosylation similar to other E. coli proteins?

While the provided search results don't specifically mention YgaM glycosylation, research on other E. coli proteins has revealed extensive O-linked glycosylation . The first search result describes how another E. coli protein (YghJ) was found to be hyperglycosylated with 54 O-linked glycosylated sites . To investigate potential YgaM glycosylation, researchers should:

  • Apply the BEMAP (Beta Elimination followed by Michael Addition with Pyridine) method, which was successful in identifying glycosylation sites in YghJ

  • Purify YgaM from both wild-type and glycosylation-deficient strains (e.g., ΔhldE mutants) for comparative analysis

  • Use mass spectrometry to identify potential glycosylation sites

  • Examine whether any identified modifications occur at serine or threonine residues, which are typical targets for O-linked glycosylation

What impact might post-translational modifications have on YgaM function?

Post-translational modifications, including potential glycosylation, could significantly influence YgaM function. Based on findings with other proteins like YghJ, which showed differential immunogenicity when glycosylated , researchers should investigate:

  • Structural impacts: Determine if modifications alter protein folding or stability using circular dichroism, thermal shift assays, and limited proteolysis

  • Functional differences: Compare the activities of modified and unmodified YgaM in relevant functional assays (e.g., ribosome binding, translation inhibition)

  • Recognition by the immune system: Assess whether modifications affect recognition by the host immune system, as was observed with YghJ

  • Localization effects: Investigate if modifications influence membrane localization or protein-protein interactions

  • Regulatory implications: Determine if modifications occur in response to specific environmental conditions, potentially serving as a regulatory mechanism

How can transcriptomic and proteomic approaches advance understanding of YgaM function?

Integrating transcriptomic and proteomic approaches provides comprehensive insights into YgaM function:

  • RNA-seq analysis: Compare transcriptomes of wild-type and ΔygaM strains under various conditions (different growth phases, stress conditions) to identify pathways affected by YgaM deletion

  • Ribosome profiling: Assess translational impacts by comparing ribosome-protected fragment patterns between wild-type and ΔygaM strains or strains with manipulated YgaM expression

  • Quantitative proteomics: Use SILAC or TMT labeling to quantify proteome-wide changes resulting from YgaM deletion or overexpression

  • Pulse-chase experiments: Measure protein synthesis and degradation rates in the presence and absence of YgaM to detect effects on protein homeostasis

  • Interactome analysis: Use pull-down approaches coupled with mass spectrometry to identify YgaM interaction partners under different conditions

What strategies can resolve contradictory findings regarding YgaM expression patterns?

The search results indicate potential contradictions in YgaM expression patterns, with regulatory systems suggesting stationary phase expression but mass spectrometry data not showing increased levels . To resolve such contradictions, researchers should implement:

  • Multiple detection techniques: Combine western blotting, mass spectrometry, and reporter gene fusions to track YgaM expression

  • Temporal resolution improvement: Conduct high time-resolution sampling during growth phase transitions to capture potentially transient expression changes

  • Strain variation analysis: Compare YgaM expression across different E. coli strains to assess strain-specific regulation

  • Condition screening: Test expression under diverse environmental conditions beyond standard laboratory media (nutrient limitation, pH stress, osmotic stress)

  • Post-transcriptional regulation investigation: Analyze mRNA stability, translation efficiency, and protein degradation rates to identify potential post-transcriptional regulatory mechanisms

What can comparative genomics reveal about YgaM conservation and evolution?

Comparative genomic analysis of YgaM across bacterial species can provide evolutionary insights:

  • Perform phylogenetic analysis of YgaM homologs across diverse bacterial species to trace evolutionary relationships

  • Identify conserved residues through multiple sequence alignment, focusing on the C-terminal domain and potential functional motifs

  • Map conservation patterns onto predicted structural models to identify functionally important regions

  • Compare genomic neighborhoods of ygaM genes across species to identify potentially co-evolving genes

  • Correlate YgaM presence/absence with specific bacterial lifestyles or ecological niches

How does the methodology for studying YgaM differ from approaches used for well-characterized proteins?

Studying uncharacterized proteins like YgaM requires specialized approaches that differ from those used for well-characterized proteins:

  • Function prediction: Employ computational approaches like structural modeling, co-evolution analysis, and genomic context to generate functional hypotheses

  • Phenotype screening: Test knockout strains under hundreds of growth conditions (Phenotype MicroArray) to identify conditions where YgaM is important

  • High-throughput interaction screening: Use global approaches (Y2H, protein arrays) rather than targeted assays to identify interacting partners without preconceived functional biases

  • Evolutionary profiling: Leverage phylogenetic patterns and genomic context to infer function based on co-occurrence with proteins of known function

  • Synthetic genetic arrays: Perform systematic genetic interaction screens to place YgaM in functional networks based on genetic interactions

What technological advances would facilitate deeper characterization of YgaM?

Several emerging technologies could accelerate YgaM characterization:

  • Cryo-EM advancements: Improved resolution for membrane protein structures would allow visualization of YgaM's precise conformation and interactions

  • Advanced protein tagging systems: Development of minimally disruptive tags specifically designed for membrane proteins would improve functional studies

  • Single-molecule techniques: Methods to study individual protein molecules could reveal dynamic behaviors masked in bulk experiments

  • Improved membrane mimetics: Better artificial membrane systems would allow more natural environments for in vitro studies

  • AI-based structure prediction: Tools like AlphaFold could provide increasingly accurate structural models for hypothesis generation

How might understanding YgaM contribute to broader knowledge of bacterial stress responses?

Characterizing YgaM could illuminate several aspects of bacterial physiology:

  • Expand understanding of specialized ribosome regulation mechanisms during stress conditions

  • Reveal novel membrane-associated signaling pathways in bacteria

  • Identify new modes of post-translational regulation in prokaryotes

  • Contribute to knowledge about bacterial protein glycosylation systems and their functional implications

  • Provide insights into stationary phase adaptation mechanisms and persistence strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.