Recombinant Escherichia coli Uncharacterized protein yggT (yggT)

What is the YggT protein and what are its basic structural features?

YggT is an uncharacterized membrane protein from Escherichia coli consisting of 188 amino acids. Its amino acid sequence (MNTLTFLLSTVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQPIIGPLRRVIPAMGP IDSASLLVAYILSFIKAIVLFKVVTFLPIIWIAGLLILLKTIGLLIFWVLLVMAIMSWVS QGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMILVLLLYVINMGVAEVLQATGNML LPGLWMAL) suggests a predominantly hydrophobic membrane protein with multiple transmembrane domains. The protein is identified in databases under UniProt ID P64564 and has several synonyms including b2952, JW2919, and "Uncharacterized protein YggT" .

How is the yggT gene organized in the E. coli genome?

The yggT gene is located adjacent to yggS in the E. coli genome, suggesting these genes may be functionally related or co-regulated. Research approaches often involve studying both genes together to understand their relationship. The genomic context indicates potential functional coupling between these genes, with yggS encoding a PLP-binding protein containing a conserved lysine residue (Lys36) that forms a Schiff base with PLP .

What evolutionary conservation does YggT demonstrate across bacterial species?

While specific conservation data isn't directly provided in the search results, the presence of YggT in protein content-based machine learning classification models suggests it may have significance across bacterial species. Proteins involved in processes like respiration, energy production, DNA repair, metabolism, and stress tolerance are often conserved across pathogenic bacteria . Evolutionary analysis typically involves multiple sequence alignments and phylogenetic tree construction to determine conservation patterns.

What expression systems are optimal for producing recombinant YggT protein?

Recombinant YggT protein can be successfully expressed in several systems, with E. coli being the most commonly used for basic research applications. The protein has been successfully expressed with N-terminal or C-terminal His-tags to facilitate purification. Alternative expression systems include yeast, mammalian cells, and insect cells, each offering advantages for different research objectives .

For membrane proteins like YggT, methodology considerations include:

• E. coli: Cost-effective and efficient for basic structural studies

• Yeast: Better for proper folding of complex eukaryotic-like structures

• Mammalian/insect cells: Optimal when post-translational modifications are crucial

What fusion tags are recommended for YggT expression and purification?

Multiple fusion tags have been utilized successfully with YggT, including:

• His-tag: Most commonly used for affinity purification via metal chelation chromatography

• FLAG-tag: Useful for immunodetection and gentle elution conditions

• MBP/GST: Enhances solubility and enables single-step purification

• GFP fusion: Allows visualization of localization and expression monitoring

For membrane proteins like YggT, His-tags are often preferred due to their small size minimizing interference with protein folding and function. The methodological approach typically involves cloning the yggT gene into expression vectors with the chosen tag either at the N- or C-terminus.

What are the optimal storage conditions for purified YggT protein?

Purified YggT protein is best stored as a lyophilized powder. For working solutions, the recommended storage buffer is Tris/PBS-based buffer with 6% trehalose at pH 8.0. To maintain protein stability, it's advisable to:

• Aliquot the protein after reconstitution to avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

• Maintain long-term storage at -20°C/-80°C

• Add 5-50% glycerol (final concentration) for long-term storage

• Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

What is the current understanding of YggT's role in osmotic regulation?

Research indicates YggT plays a significant role in osmotic regulation in E. coli. The protein appears to function in bacterial osmoregulation mechanisms, potentially through influencing ion transport or membrane permeability. Experimental data shows that YggT expression affects cellular responses to osmotic stress conditions induced by high salt (NaCl) or other osmolytes like mannitol .

Methodological approaches to study this function include:

• Growth assays comparing wild-type and yggT mutant strains under varying osmotic conditions

• Measurement of intracellular ion concentrations (particularly K+)

• Analysis of amino acid content changes in response to osmotic stress

• Complementation studies with plasmid-expressed YggT to restore phenotypes

How does YggT interact with potassium transport systems?

YggT appears to influence potassium (K+) uptake in E. coli. Studies with TK2420ΔyggS-T mutant strains show altered potassium transport compared to wild-type cells. The methodological approach involves:

• Measuring K+ uptake in cells expressing or lacking YggT

• Comparing K+ uptake kinetics under different osmotic conditions

• Analyzing the interaction between YggT and known K+ transport systems

• Examining changes in membrane potential in response to YggT expression

Research suggests that YggT may regulate membrane permeability to ions or interact with established K+ transport proteins rather than functioning as a primary K+ transporter itself .

What is the relationship between YggT and cellular amino acid content?

Experimental evidence indicates YggT expression influences amino acid content in E. coli cells, particularly under osmotic stress conditions. When E. coli TK2420ΔyggS-T cells were cultured in media containing 25 mM KCl with either 100 mM NaCl or 500 mM mannitol, significant differences in amino acid profiles were observed between cells expressing YggT and control cells .

The methodological approach involves:

• Culturing cells under defined osmotic conditions

• Preparing cell-free extracts

• Quantifying amino acid concentrations by chromatographic methods

• Normalizing amino acid content to protein concentration

• Comparing profiles between wild-type, mutant, and complemented strains

How can researchers create yggT knockout strains for functional studies?

Creating yggT knockout strains involves gene replacement techniques. The methodology described in the literature involves:

• Using the λRed-recombination system to replace yggT with a kanamycin resistance cassette

• Amplifying the kanamycin resistance cassette by PCR with primers containing homology regions to the target gene

• Transforming E. coli cells expressing the λRed recombinase with the PCR product

• Selecting transformants on kanamycin-containing media

• Confirming integration by colony PCR using gene-specific and kanamycin cassette-specific primers

For more precise genetic manipulations, CRISPR-Cas9 systems can also be employed to create scarless deletions.

What plasmid constructs are useful for YggT expression and functional studies?

Several plasmid constructs have been developed for YggT studies:

• pUT: Contains the 3'-terminal region of yggS and the whole yggT gene, designed to express YggT with a C-terminal His-tag

• pUST: Contains the whole yggS-yggT genes, expressing non-tagged YggS and His-tagged YggT

• pUS: Contains the yggS gene with a 20-bp upstream region

• pUSmT: Contains a mutated version of yggS (K36R) and wild-type YggT

These constructs enable various experimental approaches:

• Expression of YggT alone or together with YggS

• Investigation of potential functional coupling between YggS and YggT

• Complementation studies in knockout strains

• Protein-protein interaction studies

How can researchers measure YggT's impact on membrane permeability and ion transport?

Methodological approaches to assess YggT's role in membrane permeability and ion transport include:

• K+ uptake assays:

  • Culture cells in media with defined K+ concentrations

  • Harvest and wash cells to remove external K+

  • Resuspend in appropriate buffer (e.g., 120 mM Tris-HCl, pH 8.0)

  • Measure K+ uptake after addition of external K+ using ion-selective electrodes or atomic absorption spectroscopy

  • Compare uptake kinetics between wild-type and mutant strains

• Membrane potential measurements:

  • Use voltage-sensitive fluorescent dyes

  • Monitor changes in fluorescence in response to osmotic challenges

  • Compare membrane potential stability between strains with and without YggT

• Liposome reconstitution experiments:

  • Purify YggT protein

  • Reconstitute into liposomes of defined lipid composition

  • Measure ion flux across liposomal membranes

  • Determine selectivity for different ions

How might YggT contribute to bacterial stress response mechanisms beyond osmotic regulation?

While YggT is implicated in osmotic regulation, its potential role in broader stress response mechanisms is an area for advanced research. Proteins involved in osmotic regulation often participate in multiple stress response pathways. Research methodologies to explore this include:

• Transcriptomic analysis comparing yggT expression under various stress conditions (pH, temperature, oxidative stress)

• Proteomic studies to identify YggT protein interaction partners

• Growth phenotyping of yggT mutants under diverse stress conditions

• Metabolomic analysis to detect changes in cellular metabolites related to stress responses

The connection between YggT, K+ transport, and amino acid content suggests it may play a role in coordinating multiple cellular processes during adaptation to environmental challenges.

What bioinformatic approaches can predict YggT protein structure and function?

Advanced computational methods can help predict YggT structure and function:

• Transmembrane topology prediction algorithms to identify membrane-spanning regions

• Homology modeling based on structurally characterized proteins with similar sequences

• Molecular dynamics simulations to predict conformational changes in different osmotic environments

• Machine learning approaches to identify functional relationships based on genomic context

• Protein-protein interaction network analysis to predict functional partners

These computational predictions generate testable hypotheses that can guide experimental design for functional characterization.

How can structural biology techniques be applied to understand YggT mechanism?

Understanding YggT's structural basis for function requires advanced structural biology approaches:

• X-ray crystallography:

  • Express and purify large quantities of YggT protein

  • Screen crystallization conditions optimized for membrane proteins

  • Use lipidic cubic phase or bicelle crystallization methods

  • Collect diffraction data and solve the structure

• Cryo-electron microscopy:

  • Purify YggT in appropriate detergent or nanodiscs

  • Prepare grids for single-particle analysis

  • Collect and process images to generate 3D reconstructions

• Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Express isotopically labeled YggT (15N, 13C)

  • Record multidimensional NMR spectra

  • Assign resonances and calculate structure constraints

• Site-directed mutagenesis to validate structural predictions:

  • Identify potentially important residues from structural data

  • Create point mutations using PCR-based methods

  • Assess functional consequences through transport assays

What is the potential role of YggT in bacterial pathogenicity prediction models?

Recent machine learning approaches for predicting bacterial pathogenicity have identified protein families associated with pathogenicity that are involved in processes like respiration, energy production, DNA repair, metabolism, and stress tolerance. While YggT is not specifically mentioned in this context, as an osmotic regulation protein, it may contribute to bacterial adaptation during infection:

• Include YggT in feature sets for machine learning classification models

• Compare YggT sequence variations between pathogenic and non-pathogenic strains

• Assess YggT expression levels during host infection models

• Determine if YggT contributes to survival under host-imposed stress conditions

Understanding YggT's potential role in pathogenicity could provide insights into bacterial adaptation mechanisms during infection and identify new targets for antimicrobial development.

YggT Protein Characteristics and Expression Parameters

Plasmid Constructs for YggT Functional Studies

YggT and Amino Acid Content Under Different Osmotic Conditions