Recombinant Escherichia coli Uncharacterized protein ygjQ (ygjQ)

What is the ygjQ protein in Escherichia coli?

The ygjQ protein is an uncharacterized protein in Escherichia coli consisting of 230 amino acids (P42598) . It belongs to a family of proteins that are broadly conserved across bacterial species and have been shown to be indispensable for bacterial growth . The protein contains structural features suggesting potential regulatory functions, though its precise biological role remains under investigation. Current research indicates it may participate in fundamental cellular processes critical to bacterial viability.

What is the primary sequence and predicted structural features of ygjQ?

The full amino acid sequence of ygjQ is: MLRAFARLLLRICFSRRTLKIACLLLLVAGATILIADRVMVNASKQLTWSDVNAVPARNVGLLLGARPGNRYFTRRIDTAAALYHAGKVKWLLVSGDNGRKNYDEASGMQQALIAKGVPAKVIFCDYAGFSTLDSVVRAKKVFGENHITIISQEFHNQRAIWLAKQYGIDAIGFNAPDLNMKHGFYTQLREKLARVSAVIDAKILHRQPKYLGPSVMIGPFSEHGCPAQK . The protein shares features with P-loop-containing GTPases but has a unique domain architecture that includes an N-terminal RNA-binding domain, a central GTPase module, and a C-terminal cysteine cluster that resembles a zinc knuckle motif . This structural arrangement suggests potential interactions with RNA and nucleotides, which may be key to its cellular function.

How are recombinant forms of ygjQ protein typically expressed and purified?

Recombinant ygjQ protein can be expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The typical methodology involves cloning the ygjQ gene into an appropriate expression vector, transforming the construct into E. coli cells, inducing protein expression (usually with IPTG), and then purifying the protein using affinity chromatography targeting the His-tag. After purification, the protein is often stored as a lyophilized powder in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For experimental use, researchers should avoid repeated freeze-thaw cycles and consider storing working aliquots at 4°C for up to one week to maintain protein integrity.

What are the optimal storage conditions for purified ygjQ protein?

For long-term storage, purified ygjQ protein should be kept at -20°C or preferably -80°C . The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during freezing and thawing . It is recommended to aliquot the protein upon receipt to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality. For short-term use, working aliquots can be stored at 4°C for up to one week . When handling the protein, gentle centrifugation before opening the vial is advised to collect all material at the bottom of the tube.

What nucleotide hydrolysis activities have been observed for ygjQ and related proteins?

Studies on related proteins in the YjeQ family have demonstrated significant GTPase activity with unique kinetic properties . These proteins exhibit slow steady-state GTP hydrolysis, with a k(cat) of approximately 9.4 h^(-1) and a K(m) for GTP of 120 μM, yielding a specificity constant (k(cat)/K(m)) of 21.7 M^(-1)s^(-1) . Interestingly, pre-steady state kinetic analysis reveals a burst of nucleotide hydrolysis for GTP with a first-order rate constant of 100 s^(-1), which is substantially faster than the steady-state turnover rate . The protein can also hydrolyze other nucleoside triphosphates including ATP, ITP, and CTP, but with significantly lower specificity constants ranging from 0.2 to 1.0 M^(-1)s^(-1) . This enzymatic profile suggests that GTP is the preferred physiological substrate, and the substantial difference between burst and steady-state rates indicates that product release likely limits turnover.

How can site-directed mutagenesis be used to investigate the functional domains of ygjQ?

Site-directed mutagenesis represents a powerful approach to dissect the functional significance of specific residues and domains within the ygjQ protein. Based on studies of related proteins, mutations in the G1 motif of the GTPase domain, such as the S221A substitution in related YjeQ, can substantially impair GTP hydrolysis activity (reducing the burst rate from 100 s^(-1) to 0.3 s^(-1)) . To investigate ygjQ's function, researchers should target:

• Conserved residues in the predicted P-loop GTPase motifs

• Key residues in the N-terminal OB-fold RNA-binding domain

• Cysteine residues in the C-terminal zinc knuckle-like motif

Each mutant should be characterized for changes in:

• Nucleotide binding affinity

• GTPase activity (both steady-state and pre-steady state kinetics)

• RNA binding capabilities

• Protein stability and folding

• Ability to complement ygjQ-deficient strains

This systematic mutational analysis can reveal which domains and residues are essential for the protein's biochemical activities and cellular functions.

What strategies can be employed to determine the cellular role of ygjQ in E. coli?

Determining the cellular function of uncharacterized proteins like ygjQ requires an integrated experimental approach. The following methodologies are recommended:

• Conditional Knockdown/Knockout Studies: Since ygjQ likely belongs to a family of essential proteins, construct conditional mutants using temperature-sensitive alleles or controllable expression systems to observe phenotypic effects upon depletion.

• Protein-Protein Interaction Analysis: Employ techniques such as pull-down assays, bacterial two-hybrid systems, or cross-linking mass spectrometry to identify protein interaction partners, which can provide functional context.

• RNA-Protein Interaction Studies: Given the predicted RNA-binding domain, techniques such as CLIP-seq (Cross-linking immunoprecipitation followed by sequencing) can determine if ygjQ interacts with specific RNA species.

• Subcellular Localization: Use fluorescent protein fusions or immunofluorescence to track ygjQ's location within the cell under various growth conditions.

• Ribosome Association Analysis: The domain architecture of ygjQ family proteins suggests potential involvement in translation regulation . Ribosome profiling and polysome analysis can determine if ygjQ associates with ribosomes and affects translation.

• High-throughput Phenotypic Screens: Screen for conditions where ygjQ becomes particularly important (stress conditions, antibiotic exposure, nutrient limitation).

Integrating data from these approaches can provide comprehensive insights into ygjQ's cellular function.

How can mass spectrometry be applied to characterize post-translational modifications of ygjQ?

Mass spectrometry (MS) offers powerful tools for characterizing post-translational modifications (PTMs) of uncharacterized proteins like ygjQ . A comprehensive MS-based approach should include:

• Sample Preparation: Purify native ygjQ from E. coli under various growth conditions to capture physiologically relevant modifications. Compare with recombinant ygjQ to identify differences.

• Bottom-up Proteomics: Digest purified ygjQ with proteases (typically trypsin, but also consider others for better sequence coverage) and analyze resulting peptides by LC-MS/MS.

• Top-down Proteomics: Analyze intact ygjQ to determine the combinatorial pattern of modifications and protein isoforms.

• Targeted PTM Analysis: Use neutral loss scanning or precursor ion scanning to specifically detect phosphorylation, acetylation, methylation, or other common bacterial PTMs.

• Quantitative Analysis: Apply SILAC or TMT labeling to quantify changes in modification status under different growth conditions or stress responses.

• Data Analysis: Employ specialized software with appropriate search parameters for unexpected modifications, considering the uncharacterized nature of the protein.

This comprehensive MS approach can reveal regulatory mechanisms controlling ygjQ function and provide insights into its cellular role.

What experimental approaches can determine if ygjQ interacts with RNA in vivo?

Given the predicted OB-fold RNA-binding domain in the ygjQ protein family , investigating RNA interactions is crucial for understanding its function. A multi-faceted approach should include:

• CLIP-seq (Cross-linking Immunoprecipitation followed by Sequencing): This technique involves UV cross-linking proteins to their bound RNAs in vivo, followed by immunoprecipitation of the protein of interest, and sequencing of the bound RNA fragments. For ygjQ, use antibodies against the native protein or epitope tags on recombinant versions.

• RNA Electrophoretic Mobility Shift Assays (EMSA): Incubate purified ygjQ with candidate RNA molecules (such as ribosomal RNA, tRNA, or mRNA) and analyze complex formation by gel electrophoresis.

• Fluorescence Anisotropy: Measure the binding affinity of ygjQ to fluorescently labeled RNA molecules in solution, determining dissociation constants (Kd) for different RNA species.

• Surface Plasmon Resonance (SPR): Analyze real-time binding kinetics between immobilized ygjQ and flowing RNA molecules, or vice versa.

• Gradient Sedimentation Analysis: Determine if ygjQ co-sediments with ribosomes or other RNA-containing complexes during centrifugation through sucrose gradients.

• RNA Footprinting: Identify specific RNA regions protected by ygjQ binding using nuclease protection assays or chemical probing methods.

• Microscopy-based Approaches: Employ fluorescence microscopy with labeled ygjQ and RNA to visualize co-localization in vivo.

Integration of results from these complementary approaches can provide strong evidence for physiologically relevant RNA interactions and identify specific RNA targets of ygjQ.

How can computational approaches aid in predicting ygjQ function?

Computational approaches are increasingly valuable for understanding uncharacterized proteins like ygjQ . A comprehensive bioinformatic analysis should include:

• Sequence-based Function Prediction:

  • PSI-BLAST and HHpred for distant homology detection

  • Functional domain prediction using InterPro, PFAM, and CDD

  • Conservation analysis across bacterial species to identify essential residues

• Structural Prediction and Analysis:

  • AlphaFold2 or RoseTTAFold to generate protein structure models

  • Molecular docking of potential substrates (GTP, RNA)

  • Molecular dynamics simulations to study conformational changes

• Genomic Context Analysis:

  • Examine operonic associations and gene neighborhood conservation

  • Phylogenetic profiling to identify co-evolving genes

  • Protein-protein interaction network prediction

• Expression Correlation Analysis:

  • Mining transcriptomic datasets to identify genes with similar expression patterns

  • Analysis of differential expression under various stress conditions

• Integration with Experimental Data:

  • Incorporate mass spectrometry data to refine structural models

  • Update predictions based on experimental findings

The computational predictions should be used to guide experimental design, creating an iterative cycle of prediction and validation that accelerates functional characterization.

What protein-protein interaction methods are most effective for studying ygjQ's interactome?

Understanding the protein interaction network of ygjQ is essential for elucidating its cellular function. The following complementary approaches are recommended:

• Affinity Purification coupled with Mass Spectrometry (AP-MS):

  • Express His-tagged ygjQ in E. coli

  • Perform gentle lysis to preserve native complexes

  • Use Ni-NTA or other affinity resins for purification

  • Identify co-purifying proteins by mass spectrometry

  • Include appropriate controls (e.g., untagged strain, different tag positions)

• Bacterial Two-Hybrid (B2H) System:

  • Screen ygjQ against an E. coli genomic library

  • Validate positive interactions with targeted B2H assays

  • Consider using the adenylate cyclase-based or λ repressor-based systems

• In vivo Cross-linking followed by Mass Spectrometry (XL-MS):

  • Use cell-permeable cross-linkers of different spacer lengths

  • Identify cross-linked peptides by specialized MS analysis

  • Map interaction interfaces at amino acid resolution

• Co-immunoprecipitation (Co-IP):

  • Develop antibodies against native ygjQ or use tag-specific antibodies

  • Perform IPs under various growth conditions to capture condition-specific interactions

• Proximity-based Labeling:

  • Fuse ygjQ to enzymes like BioID or APEX2

  • Identify proteins in close proximity through biotinylation and streptavidin purification

• Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI):

  • Confirm direct interactions and determine binding kinetics

  • Test specific candidate interactors identified from high-throughput methods

A combination of these approaches will provide a comprehensive view of ygjQ's interaction network while minimizing false positives and negatives inherent to individual methods.

How can researchers resolve contradictory data regarding ygjQ function?

Investigating uncharacterized proteins frequently yields apparently contradictory results. When confronting inconsistent data about ygjQ function, researchers should:

• Systematically Compare Experimental Conditions:

  • Create a comprehensive table comparing buffer compositions, temperatures, protein concentrations, and other variables between conflicting experiments

  • Test if differences in experimental conditions explain the contradictions

  • Consider if the protein's concentration-dependent oligomerization might cause different behaviors

• Analyze Protein Quality and Modifications:

  • Verify protein integrity using SDS-PAGE, mass spectrometry, and circular dichroism

  • Check for batch-to-batch variations in recombinant protein preparations

  • Assess if different purification methods retain or remove important cofactors

• Examine Biological Context:

  • Test if ygjQ has different activities in different cellular compartments

  • Investigate if interaction partners modulate its function

  • Consider if growth conditions affect its activity

• Use Complementary Methodologies:

  • Apply orthogonal techniques to validate key findings

  • Develop new assays that can bridge contradictory results

• Consider Pleiotropy:

  • Evaluate if ygjQ might have multiple distinct functions

  • Map different activities to different structural domains

• Address Knowledge Graph Inconsistencies:

  • Apply anti-pattern detection approaches similar to those used for analyzing inconsistent knowledge graphs

  • Identify common patterns of contradiction in the available data

By systematically addressing these aspects, researchers can often reconcile apparently contradictory data and develop a more nuanced understanding of ygjQ's function.

What common technical challenges arise when working with recombinant ygjQ protein?

Researchers working with recombinant ygjQ may encounter several technical challenges that can impact experimental outcomes:

• Protein Solubility Issues:

  • The protein may form inclusion bodies during overexpression

  • Optimization strategies include: lowering induction temperature, reducing IPTG concentration, co-expression with chaperones, and using solubility-enhancing fusion tags

• Protein Stability Concerns:

  • YgjQ may be prone to aggregation or degradation

  • Stabilization approaches include: optimizing buffer composition (especially pH and salt concentration), adding stabilizing agents like glycerol or trehalose , and determining the optimal protein concentration range

• Enzymatic Activity Variability:

  • Based on studies of related proteins, enzymatic activity may be sensitive to preparation methods

  • The slow steady-state kinetics (k(cat) of approximately 9.4 h^(-1)) requires carefully designed assays with extended time courses

  • The burst kinetics observed in related proteins necessitates specialized pre-steady state kinetic analysis

• His-tag Interference:

  • The N-terminal His-tag commonly used for purification may affect protein function

  • Compare N-terminal, C-terminal, and cleavable tag designs

  • Include tag-free protein controls in critical experiments

• Cofactor Requirements:

  • The protein may require specific metal ions (particularly zinc, given the predicted zinc knuckle-like motif)

  • Test activity in the presence of various divalent cations and after EDTA treatment

• RNA Contamination:

  • The predicted RNA-binding domain may cause co-purification of E. coli RNA

  • Include RNase treatment steps during purification when RNA-free protein is required

  • Monitor RNA content by measuring A260/A280 ratios

How might understanding ygjQ function contribute to antimicrobial development?

The ygjQ protein belongs to a family that has been shown to be indispensable for bacterial growth in both E. coli and B. subtilis , making it a promising target for antimicrobial development. Research in this direction should consider:

• Target Validation:

  • Confirm essentiality across clinically relevant bacterial pathogens

  • Determine if partial inhibition is sufficient to impair bacterial growth

  • Assess target vulnerability using CRISPRi knockdown with titrated expression levels

• Structural Basis for Selectivity:

  • Compare bacterial ygjQ homologs with any related human proteins

  • Identify structural differences that could be exploited for selective inhibition

  • Focus on the unique circularly permuted GTPase domain as a distinguishing feature

• Inhibitor Discovery Approaches:

  • Develop high-throughput screening assays based on GTPase activity

  • Design GTP analogs that selectively inhibit the protein

  • Use fragment-based drug discovery targeting unique structural pockets

  • Exploit the potentially slow GTP hydrolysis rate (k(cat) of 9.4 h^(-1)) for assay development

• Resistance Potential Assessment:

  • Evaluate the conservation of key functional residues across bacterial species

  • Generate and characterize resistant mutants in laboratory settings

  • Assess fitness costs associated with resistance mutations

• Combination Therapy Strategies:

  • Identify synergistic interactions with existing antibiotics

  • Target multiple steps in pathways involving ygjQ

This research direction is particularly promising given the urgent need for novel antibacterial targets in the face of rising antimicrobial resistance.

What are the most promising directions for future research on ygjQ?

Based on current knowledge and the characteristics of the ygjQ protein family, several high-priority research directions emerge:

• Structural Biology:

  • Determine high-resolution structures of ygjQ in different nucleotide-bound states

  • Investigate conformational changes during the GTPase cycle

  • Elucidate the structural basis for the unusually slow steady-state kinetics observed in related proteins

• Systems Biology Integration:

  • Map the position of ygjQ in bacterial regulatory networks

  • Determine how ygjQ responds to environmental stresses

  • Identify genetic interactions through synthetic lethality screens

• Evolutionary Studies:

  • Trace the evolution of the unique circularly permuted GTPase domain

  • Compare functions across diverse bacterial species

  • Investigate if horizontal gene transfer has influenced ygjQ distribution

• Technological Applications:

  • Explore the potential of ygjQ as a molecular switch in synthetic biology circuits

  • Develop ygjQ-based biosensors for GTP levels or associated cellular processes

• Translational Research:

  • Evaluate ygjQ as a biomarker for specific bacterial infections

  • Develop diagnostic tools based on ygjQ detection

  • Explore vaccine potential of ygjQ for bacterial pathogens

These research directions leverage the unique features of ygjQ while addressing gaps in current understanding, potentially yielding both fundamental insights and practical applications.