Recombinant Escherichia coli Uncharacterized protein YhiD (yhiD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Uncharacterized Protein YhiD (yhiD)

Recombinant YhiD (gene identifier yhiD, UniProt ID P0AFV2) is an uncharacterized protein in Escherichia coli K-12, also annotated as yhhE, b3508, or JW5670. While its precise biological function remains unclear, structural and proteomic studies suggest potential roles in magnesium transport or cellular metabolism . Commercial recombinant YhiD is produced as a full-length protein (1–215 amino acids) fused with an N-terminal His-tag, enabling affinity purification and biochemical analysis .

Sequence and Domain Architecture

YhiD lacks annotated functional domains but exhibits sequence features consistent with membrane-associated or transport-related proteins. Its full-length sequence includes:

  • N-terminal His-tag for purification.

  • 215 amino acids, with a predicted molecular weight of ~25 kDa (estimated from sequence composition).

  • Cysteine-rich regions (e.g., C-terminal motifs), though their functional significance remains unexplored .

Recombinant Expression and Purification

ParameterValue
Expression SystemE. coli (strain unspecified)
TagN-terminal His tag (6xHis)
Purity>90% (SDS-PAGE analysis)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 (lyophilized)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol added for stability .

Putative Roles and Functional Modules

YhiD has been implicated in:

  1. Magnesium Transport: Annotated as a putative magnesium transporter based on sequence homology, though experimental validation is lacking .

  2. Protein Synthesis or RNA Metabolism: Proteomic studies link YhiD to networks involving ribosomal proteins, RNA helicases, and degradosome components, suggesting a role in translation regulation or mRNA stability .

Comparative Host Strain Analysis

Recent metabolic burden studies highlight strain-specific differences in recombinant protein production. For example:

  • DH5α vs. M15 strains: YhiD expression may vary due to differences in transcriptional machinery, lipid biosynthesis, or nutrient uptake pathways .

Research Applications

  • Structural Studies: Recombinant YhiD enables X-ray crystallography or NMR analysis to elucidate its fold and binding interactions.

  • Functional Screening: Knockout mutants (ΔyhiD) could reveal phenotypic effects on magnesium homeostasis or growth under stress conditions.

Challenges and Unanswered Questions

  1. Functional Elucidation: No direct evidence links YhiD to magnesium transport or translation regulation.

  2. Structural Data: Limited availability of crystal structures or interaction partners hinders mechanistic insights.

  3. Redundancy: Potential functional overlap with paralogs (e.g., yhhE) complicates phenotypic analysis.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may exist. Should you have a preference for the format, please clearly indicate it during order placement. We will then prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method and location. We encourage you to consult with your local distributor for specific delivery estimates.
Note: All of our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own adjustments.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is typically 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is typically determined during production, we are open to accommodating specific tag requests. If you have a preferred tag type, please let us know and we will prioritize developing it for you.
Synonyms
yhiD; yhhE; b3508; JW5670; Putative magnesium transporter YhiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yhiD
Target Protein Sequence
MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS
Uniprot No.

Target Background

Function
This protein may play a role in magnesium uptake.
Database Links
Protein Families
MgtC/SapB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing recombinant YhiD protein in E. coli?

The selection of an appropriate expression system is critical for successful production of uncharacterized proteins like YhiD. Research indicates that medium to low copy number vectors often yield better protein production than high copy plasmids . For example, vectors containing the p15A origin of replication demonstrated higher expression levels compared to high copy vectors in similar experimental setups .

When expressing membrane proteins or uncharacterized proteins, the combination of promoter strength and vector copy number significantly impacts expression efficiency. Strong promoters (like P trc) in combination with low copy vectors have shown up to threefold higher expression than P T7 and 5.5-fold higher than Plac promoters in comparable systems . For YhiD expression, a system using the pSF-p15A backbone with a trc promoter would likely provide optimal conditions, as similar configurations yielded up to 53.09 mg/L of recombinant protein in comparable studies .

How can I confirm successful expression of an uncharacterized protein like YhiD?

Confirming expression of uncharacterized proteins requires multiple verification methods:

  • SDS-PAGE analysis: Run soluble and insoluble fractions to determine protein presence and distribution

  • Western blotting: Using antibodies against fusion tags (His, GST, or FLAG) if the native protein lacks reliable antibodies

  • Mass spectrometry: For definitive identification of the expressed protein

  • Functional assays: Develop based on predicted protein characteristics or homology models

Quantitative analysis should include densitometric measurements of protein bands, similar to approaches used for other recombinant proteins in E. coli . When working with uncharacterized proteins like those in the UPF0016 family, confirmation of expression often relies on fusion tags or reporter systems until specific antibodies become available .

What are the most common challenges in expressing uncharacterized proteins like YhiD?

Expressing uncharacterized proteins presents several challenges that require methodological solutions:

  • Inclusion body formation: Studies show that even with optimized expression systems, a significant percentage of recombinant protein can form insoluble aggregates . For instance, expression under P BAD promoter control showed lower insoluble fraction compared to other promoters in similar experimental setups .

  • Metabolic burden: The metabolic load imposed by protein overexpression can significantly impact cell growth and protein yields. Research has demonstrated that the combination of high copy number plasmids with strong promoters causes metabolic mismatch and decreased productivity .

  • Protein toxicity: Membrane or regulatory proteins may disrupt cellular processes when overexpressed.

  • Improper folding: Without known structural information, achieving proper folding can be particularly challenging.

A strategic approach involves testing multiple expression conditions, including various promoters, induction temperatures (20°C, 30°C, 37°C), and carbon sources (glucose vs. glycerol) .

How should I design experiments to characterize the function of YhiD as an uncharacterized protein?

Characterizing uncharacterized proteins requires a systematic experimental design approach:

  • Sequential hypothesis testing: Start with bioinformatic predictions of protein function based on sequence motifs and structural homology. For instance, if YhiD contains motifs similar to the UPF0016 family (e.g., Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr)), it may suggest membrane transport functionality .

  • Controlled variable manipulation: Following true experimental design principles, systematically manipulate independent variables while controlling for extraneous factors . For YhiD characterization, this might include:

    Independent VariableLevels to TestDependent VariableControl Factors
    Growth conditionsAerobic, Anaerobic, MicroaerobicYhiD expression levelsTemperature, media composition
    Stress conditionspH, osmotic, oxidative stressCellular phenotypeGrowth phase, strain background
    Metal ionsCa²⁺, Mg²⁺, Mn²⁺, Zn²⁺Protein activitypH, temperature, buffer composition
    Gene knockoutsRelated pathway genesMetabolic fluxGrowth conditions, carbon source
  • Randomization: Ensure random distribution of experimental units to treatment groups to prevent selection bias and control for confounding variables .

  • Replication: Include sufficient biological and technical replicates, with statistical power analysis to determine appropriate sample sizes .

An approach using complementary methods (biochemical assays, phenotypic analyses, and omics techniques) provides the most robust characterization strategy for uncharacterized proteins like YhiD.

What strategies can resolve solubility issues when expressing YhiD protein?

Addressing solubility challenges requires a multi-faceted approach:

  • Expression optimization: Research has shown that even with optimal expression systems, recombinant proteins can form significant insoluble fractions. For example, studies with YFP expression vectors demonstrated that cultures containing pSF-p15A-trc-YFP and pSF-p15A-tac-YFP showed similar percentages of soluble and insoluble protein despite high expression levels .

  • Fusion tags selection: Various solubility-enhancing tags can be empirically tested:

    Fusion TagMolecular WeightSolubility EnhancementPurification Method
    MBP42 kDaHighAmylose resin
    SUMO11 kDaModerate to highNi-NTA (with His)
    Thioredoxin12 kDaModerateVarious
    GST26 kDaModerateGlutathione
    NusA55 kDaHighVarious
  • Chaperone co-expression: Co-expressing molecular chaperones (GroEL/ES, DnaK/J, trigger factor) can significantly improve folding of difficult proteins.

  • Inclusion body recovery: If YhiD consistently forms inclusion bodies, solubilization and refolding protocols can be developed using chaotropic agents (urea, guanidine-HCl) followed by controlled dialysis.

Research has demonstrated that the percentage of soluble versus insoluble protein varies significantly based on the expression system, with P BAD promoter systems showing improved solubility profiles compared to stronger promoters in comparable experimental setups .

How can I investigate potential interaction partners of YhiD?

Investigating protein-protein interactions for uncharacterized proteins requires strategic experimental approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express tagged YhiD (His, FLAG, or Strep tag) to capture protein complexes under near-physiological conditions.

  • Bacterial two-hybrid screening: Systematic testing for binary interactions with E. coli proteome subsets. This approach uses the following experimental design:

    ComponentSystem 1System 2System 3
    BaitYhiD-T18YhiD-λcIYhiD-LexA
    PreyT25-libraryRNA polymerase-libraryB42-library
    Reporterβ-galactosidaseReporter geneLEU2 or lacZ
    SelectionBlue/whiteGrowthGrowth or color
  • Proximity-dependent biotin labeling (BioID or APEX): For capturing transient or weak interactions within the native cellular environment.

  • Co-immunoprecipitation: If antibodies are available or using epitope-tagged versions of YhiD.

  • Genetic approaches: Synthetic lethality screening, suppressor analysis, and genetic interaction mapping can reveal functional relationships.

For membrane proteins or proteins of unknown function, combining multiple complementary approaches yields the most reliable interaction data. When analyzing results, statistical methods for controlling false discovery rates are essential for distinguishing true interactions from background contaminants.

What promoter systems are most effective for controlled expression of YhiD protein?

The choice of promoter significantly impacts recombinant protein expression success. Research has demonstrated distinct expression profiles with different promoter systems:

  • Trc promoter: Achieved the highest expression levels (up to 53.09 mg/L) when combined with low-copy p15A origin vectors . This represents a threefold higher expression than P T7 and 5.5-fold higher than Plac in comparable systems .

  • BAD promoter: Showed improved performance with high copy plasmids, likely due to its weaker strength compared to lac-derived promoters . This promoter also demonstrated reduced insoluble protein fraction formation compared to stronger promoters .

  • T7 promoter: Despite being widely used for recombinant protein expression, showed only moderate expression levels for proteins similar to YhiD when compared to trc promoter systems .

For uncharacterized proteins like YhiD, which may have unknown functional characteristics or potential toxicity, tightly regulated promoter systems are advisable. The following table summarizes promoter characteristics based on experimental data:

PromoterRegulationRelative StrengthLeakinessInduction MethodSuitable for Toxic Proteins
PtrcModerateHighModerateIPTGNo
PBADTightMediumLowL-arabinoseYes
PT7TightVery highModerateIPTGNo
PlacModerateLow-MediumHighIPTGYes

For YhiD expression, starting with the PBAD system would be recommended if toxicity is a concern, while the trc promoter would be optimal for maximum expression if the protein does not negatively impact cell viability .

How does carbon source selection affect YhiD expression in E. coli?

The choice of carbon source significantly impacts recombinant protein expression efficiency. Experimental evidence shows:

  • Glycerol versus glucose: Studies demonstrated that E. coli grown with glycerol as carbon source achieved higher recombinant protein expression compared to glucose-supplemented cultures, with the maximum expression observed in wild-type E. coli growing with glycerol transformed with the plasmid pSF-p15A-trc-YFP .

  • Metabolic impact: Glucose can cause carbon catabolite repression, affecting the expression from certain promoters. Additionally, acetate accumulation during glucose metabolism can negatively impact protein expression and cell growth .

  • Strain-specific effects: The carbon source impact varies between wild-type and metabolically engineered strains. For instance, the Δ ackA mutant (deficient in acetate kinase) showed differential expression patterns compared to wild-type when grown on different carbon sources .

For YhiD expression, initial trials should compare glycerol-supplemented media with traditional glucose-based formulations. Based on comparable studies, glycerol supplementation could potentially increase expression yields by 15-40% depending on the specific expression system employed .

What analytical techniques are most informative for structural and functional characterization of uncharacterized proteins like YhiD?

Comprehensive characterization of uncharacterized proteins requires multiple complementary analytical approaches:

  • Structural analysis:

    • X-ray crystallography for high-resolution structural determination

    • Cryo-electron microscopy for membrane proteins or large complexes

    • NMR spectroscopy for dynamic structural information

    • Small-angle X-ray scattering (SAXS) for solution-state structural envelopes

  • Functional assessment:

    • Phenotypic analysis of knockout/overexpression strains

    • Metabolomic profiling to identify altered metabolic pathways

    • Transcriptomic analysis to identify gene expression changes

    • Membrane transport assays if predicted to be a transporter

  • Biochemical characterization:

    • Enzymatic activity assays based on predicted function

    • Binding assays for potential substrates or interactors

    • Thermal shift assays for stability assessment and ligand binding

    • Circular dichroism for secondary structure assessment

For proteins belonging to uncharacterized families, such as UPF0016, sequence motif analysis can provide initial functional hints, such as the conserved Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr) motif that suggests potential membrane transport or ion channel activity .

How can I distinguish between experimental artifacts and genuine findings when working with YhiD?

Distinguishing true results from artifacts when working with uncharacterized proteins requires rigorous experimental design and controls:

  • True experimental design implementation: Follow the core principles of experimental design including randomization, replication, and controlled variable manipulation . This requires:

    • Proper randomization of samples to treatment groups

    • Inclusion of appropriate positive and negative controls

    • Blinding of sample identity during analysis where feasible

    • Statistical power analysis to determine adequate sample sizes

  • Multiple detection methods: Validate findings using orthogonal techniques:

    Primary MethodConfirmatory MethodControl for Artifact
    Western blotMass spectrometryNon-specific antibody binding
    Phenotypic assayComplementation testStrain-specific effects
    OverexpressionCRISPR interferenceNon-physiological levels
    Fluorescent taggingSubcellular fractionationTag interference
  • System-specific controls: For uncharacterized proteins, include:

    • Expression of known proteins under identical conditions

    • Parallel expression of tagged and untagged versions

    • Tests with functionally validated homologs from related organisms

    • Empty vector controls for phenotypic assessments

  • Data verification: Apply statistical methods to distinguish signal from noise:

    • Use appropriate statistical tests (ANOVA, t-tests) with correction for multiple comparisons

    • Evaluate effect sizes, not just statistical significance

    • Implement reproducibility assessments across independent experiments

What computational approaches can predict YhiD function before experimental validation?

Computational prediction of function for uncharacterized proteins involves several complementary approaches:

  • Sequence-based predictions:

    • Hidden Markov Model (HMM) profiling against known protein domains

    • Identification of conserved sequence motifs

    • Multiple sequence alignment with functionally characterized homologs

    • Phylogenetic analysis to identify orthologs with known functions

  • Structure-based predictions:

    • Homology modeling using structurally characterized templates

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Molecular docking to predict potential binding partners

    • Active site prediction and comparison with known enzyme families

  • Systems biology approaches:

    • Gene neighborhood analysis across different bacterial species

    • Gene co-expression network analysis

    • Protein-protein interaction prediction

    • Phenotype-based function prediction using genome-wide datasets

For proteins in uncharacterized families like UPF0016, which contains conserved motifs such as Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr), these computational predictions can provide initial hypotheses about potential membrane transport functions, subcellular localization, or involvement in specific cellular processes .

How can I design a systematic gene knockout/complementation study to determine YhiD function?

A systematic knockout/complementation approach requires careful experimental design following these steps:

  • Generation of clean knockout strains:

    • Gene deletion using λ-Red recombineering system

    • CRISPR-Cas9 based genome editing

    • Verification of knockout by PCR, sequencing, and expression analysis

  • Phenotypic characterization:

    Condition to TestMeasurementsTechnical Considerations
    Standard growthGrowth rate, cell morphologyMultiple media types
    Stress conditionsSurvival ratespH, temperature, osmotic stress
    Metabolic profilingMetabolite concentrationsVarious carbon sources
    Membrane integrityPermeability assaysMultiple indicators
  • Complementation strategy:

    • Wild-type gene under native promoter

    • Wild-type gene under inducible promoter

    • Site-directed mutants targeting conserved residues

    • Homologs from related organisms

  • Controls and validation:

    • Empty vector controls

    • Complementation with unrelated genes

    • Restoration of original locus (genetic reversion)

    • Dosage dependency assessment

This approach should follow true experimental design principles by:

  • Randomizing experimental units to prevent bias

  • Including sufficient biological and technical replicates

  • Controlling for extraneous variables

  • Using appropriate statistical methods for data analysis

For uncharacterized proteins like YhiD, complementation with homologs from well-studied organisms can provide additional functional insights while mutational analysis of conserved motifs can help identify critical functional residues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.