Recombinant Escherichia coli Uncharacterized protein yhjU (yhjU)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

yhjU is encoded by the b3538 locus (JW3506) in E. coli K-12 MG1655 . Key molecular features include:

Table 2: Expression Systems and Optimization

ParameterDetails
Host StrainE. coli BL21(DE3), Origami
VectorpET-30a(+), pSF-p15A-trc-YFP
Fusion TagsHexahistidine (His₆) for affinity purification
Solubility ChallengesAggregation due to transmembrane domains; use of detergents (LMNG)
Yield OptimizationLow-copy plasmids (p15A origin) improve soluble yield

Challenges in Recombinant Production

yhjU’s recombinant expression faces hurdles common to membrane-associated proteins:

  • Inclusion Body Formation: High-level expression often leads to misfolding; chaperones (GroEL/GroES) or low-temperature induction improve solubility .

  • Toxicity: Basal expression of yhjU inhibits cell growth; tight promoter control (e.g., T7/lac) and engineered strains (C41/C43) mitigate this .

  • Purification: Detergent screening (e.g., LMNG, DDM) is critical for stabilizing the native conformation .

Future Directions and Applications

yhjU’s role in transcriptional regulation positions it as a potential tool for:

  • Metabolic Engineering: Modulating stress-response pathways to enhance bioreactor yields .

  • Antibiotic Development: Targeting yhjU-DNA interactions to disrupt bacterial viability .

  • Systems Biology: Integrating yhjU into E. coli transcriptional network models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag type whenever possible.
Synonyms
bcsG; yhjU; b3538; JW3506; Cellulose biosynthesis protein BcsG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-559
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
bcsG
Target Protein Sequence
MTQFTQNTAMPSSLWQYWRGLSGWNFYFLVKFGLLWAGYLNFHPLLNLVFAAFLLMPLPR YSLHRLRHWIALPIGFALFWHDTWLPGPESIMSQGSQVAGFSTDYLIDLVTRFINWQMIG AIFVLLVAWLFLSQWIRITVFVVAILLWLNVLTLAGPSFSLWPAGQPTTTVTTTGGNAAA TVAATGGAPVVGDMPAQTAPPTTANLNAWLNNFYNAEAKRKSTFPSSLPADAQPFELLVI NICSLSWSDIEAAGLMSHPLWSHFDIEFKNFNSATSYSGPAAIRLLRASCGQTSHTNLYQ PANNDCYLFDNLSKLGFTQHLMMGHNGQFGGFLKEVRENGGMQSELMDQTNLPVILLGFD GSPVYDDTAVLNRWLDVTEKDKNSRSATFYNTLPLHDGNHYPGVSKTADYKARAQKFFDE LDAFFTELEKSGRKVMVVVVPEHGGALKGDRMQVSGLRDIPSPSITDVPVGVKFFGMKAP HQGAPIVIEQPSSFLAISDLVVRVLDGKIFTEDNVDWKKLTSGLPQTAPVSENSNAVVIQ YQDKPYVRLNGGDWVPYPQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of the uncharacterized protein yhjU in E. coli?

While the specific function of yhjU remains to be fully elucidated, bioinformatics analyses suggest it may belong to a family of proteins involved in membrane processes. Similar uncharacterized proteins in E. coli such as YdjA and YhjY have been linked to biohydrogen production through metabolic pathways involving formate degradation . Sequence homology and structural prediction tools indicate yhjU may have enzymatic activity related to cell envelope biogenesis or stress response. Initial characterization should include sequence alignment with characterized proteins, domain prediction, and phylogenetic analysis to establish evolutionary relationships with proteins of known function.

What expression systems are most effective for producing recombinant yhjU protein?

For high-yield production of recombinant yhjU, E. coli remains the preferred expression system due to its rapid growth, economic advantages, and high protein yields. Two particularly effective methods include:

  • Autoinduction Method: This approach eliminates the need for monitoring culture density and manual addition of inducers. The culture automatically initiates protein expression as it transitions to the late logarithmic phase, allowing for high cell density (OD600 of 10-20) and consequently higher protein yields .

  • High-Cell-Density IPTG Induction: This method involves growing cultures to high density before inducing with IPTG. Optimization of media composition, particularly carbon and nitrogen sources, is critical for achieving maximum yields .

For membrane proteins like yhjU, consider using E. coli strains specifically engineered for membrane protein expression, such as C41(DE3) or C43(DE3), which better tolerate potential toxicity associated with membrane protein overexpression.

What basic characterization assays should be performed first when studying yhjU?

Initial characterization of yhjU should follow a systematic approach:

  • Expression Verification: Western blotting with anti-His or anti-tag antibodies to confirm successful expression.

  • Subcellular Localization: Fractionation studies to determine if yhjU localizes to the membrane, cytoplasm, or periplasm.

  • Protein Solubility Assessment: Solubility tests using different detergents if the protein is membrane-associated.

  • Basic Biochemical Characterization: Determination of molecular weight, oligomeric state, and stability under different conditions.

  • Preliminary Functional Assays: Based on bioinformatic predictions, design initial activity assays similar to those used for YdjA and YhjY, which were tested for their roles in hydrogen metabolism .

These initial characterizations provide the foundation for more sophisticated functional studies and experimental design decisions.

How should I design experiments to determine if yhjU is involved in biohydrogen production like other uncharacterized E. coli proteins?

To investigate potential involvement of yhjU in biohydrogen production, design a comprehensive experimental approach:

  • Gene Knockout Studies:

    • Create a yhjU deletion mutant using the Keio collection methodology

    • Compare hydrogen production between wild-type and ΔyhjU strains

    • Measure hydrogen using chemochromic membranes (palladium-covered WO3 films) as used for YdjA and YhjY studies

  • Complementation Analysis:

    • Reintroduce yhjU on an expression plasmid into the knockout strain

    • Verify restoration of phenotype to confirm the role of yhjU

  • Metabolite Analysis:

    • Use HPLC to analyze organic acid composition similar to the approach used for YdjA and YhjY

    • Focus on formate, lactate, and other fermentation products as shown in Table 1

MetaboliteWild-type (mM)ΔyhjU (mM)Complemented strain (mM)
Formate[control value][test value][verification value]
Lactate[control value][test value][verification value]
Acetate[control value][test value][verification value]
Succinate[control value][test value][verification value]
  • Formate Fermentation Test:

    • Assess biohydrogen production using formate as a carbon source

    • This would test specifically for formate hydrogen lyase (FHL) activity defects

  • Gene Expression Analysis:

    • Perform qRT-PCR to measure expression changes in known hydrogen production genes

This systematic approach will provide multiple lines of evidence regarding the potential role of yhjU in biohydrogen metabolism.

What strategies should I use to resolve contradictory data when characterizing yhjU function?

When faced with contradictory data during yhjU characterization, employ these systematic resolution strategies:

  • Independent Methodological Validation:

    • Verify results using alternative experimental approaches

    • For example, if genetic knockout shows one phenotype but biochemical assays suggest another, consider protein-protein interaction studies or metabolomics

  • Condition-Dependent Analysis:

    • Test function under different growth conditions (aerobic vs. anaerobic, different carbon sources)

    • Create a comprehensive data matrix to identify condition-specific functions

  • Temporal Expression Profiling:

    • Analyze expression at different growth phases

    • Contradictions may be explained by growth phase-specific functions

  • Multi-omics Integration:

    • Combine transcriptomic, proteomic, and metabolomic approaches

    • Use computational tools to identify patterns not obvious in single datasets

  • Epistasis Analysis:

    • Generate double mutants with genes in suspected related pathways

    • Determine genetic interactions that may explain contradictory results

  • Control Experiment Expansion:

    • Include additional positive and negative controls

    • Test closely related uncharacterized proteins (like YhjY) in parallel

Remember that contradictions often lead to novel discoveries about protein multifunctionality or condition-dependent activity.

How can I design experiments to determine if yhjU interacts with known components of the formate hydrogen lyase complex?

To investigate potential interactions between yhjU and the formate hydrogen lyase (FHL) complex, employ these methodologies:

  • Co-immunoprecipitation (Co-IP):

    • Tag yhjU with an epitope tag (His, FLAG, etc.)

    • Perform pull-down experiments followed by mass spectrometry to identify interacting partners

    • Verify specific interactions with known FHL components through western blotting

  • Bacterial Two-Hybrid Analysis:

    • Create fusion constructs of yhjU and known FHL components

    • Screen for protein-protein interactions in vivo

    • Quantify interaction strength using reporter gene assays

  • Proximity Labeling:

    • Use BioID or APEX2 techniques to identify proteins in close proximity to yhjU in living cells

    • This approach is particularly valuable for transient or weak interactions

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions to visualize potential interactions in living cells

    • Measure FRET efficiency to quantify the strength of interactions

  • Genetic Epistasis Analysis:

    • Generate double knockouts combining ΔyhjU with deletions of known FHL components

    • Compare phenotypes to single mutants to establish pathway relationships

    • Structure similar to the analysis performed for YdjA and YhjY

  • Biochemical Enzyme Assays:

    • Measure FHL activity in the presence and absence of purified yhjU protein

    • Determine if yhjU affects the kinetics of formate conversion to H₂ and CO₂

These complementary approaches will provide robust evidence for or against yhjU interactions with the FHL complex.

What are the best experimental conditions for achieving high-yield expression of yhjU protein in E. coli?

For optimal expression of yhjU in E. coli, implement these methodological approaches:

  • Host Strain Selection:

    • For membrane proteins like yhjU, C41(DE3) or C43(DE3) strains often provide better expression

    • Consider using strains with reduced protease activity (BL21, Rosetta) to minimize degradation

  • Expression Vector Optimization:

    • Use vectors with tunable promoter strength (T7lac, araBAD)

    • Incorporate fusion tags that enhance stability and solubility (MBP, SUMO)

    • Consider codon optimization if expression levels are low

  • Culture Conditions:

    • Implement high-cell-density approaches using rich media formulations

    • For autoinduction: Use 0.5% glycerol, 0.05% glucose, and 0.2% lactose in base medium

    • For IPTG induction: Grow to OD₆₀₀ of 8-10 before induction with 0.1-0.5 mM IPTG

  • Temperature Management:

    • Reduce temperature to 16-25°C post-induction to enhance proper folding

    • Extend expression time to compensate for slower protein synthesis

  • Media Supplementation:

    • For membrane proteins, supplement with specific phospholipids or membrane components

    • Add protease inhibitors to prevent degradation

These approaches routinely yield 14-25 mg of labeled proteins and 17-34 mg of unlabeled proteins from a 50-mL culture when properly optimized .

How should I design controls for a knockout study investigating yhjU function?

A robust experimental design for yhjU knockout studies requires carefully planned controls:

  • Genetic Controls:

    • Wild-type strain: The unmodified parent strain (e.g., BW25113)

    • Deletion verification: PCR confirmation of successful gene deletion

    • Complementation control: ΔyhjU strain with plasmid-expressed yhjU

    • Empty vector control: ΔyhjU strain with empty expression plasmid

    • Related gene knockout: Deletion of a functionally related gene (e.g., yhjY)

  • Experimental Controls:

    • Positive phenotype control: Knockout of a gene with known effect on your measured phenotype

    • Negative phenotype control: Knockout of a gene with no effect on your measured phenotype

    • Technical replicates: Multiple measurements from the same biological sample

    • Biological replicates: At least 3 independent cultures for each strain

  • Statistical Design:

    • Randomization: Randomize sample processing order

    • Blinding: When possible, blind the researcher to sample identity during analysis

    • Power analysis: Calculate appropriate sample size before beginning experiments

  • Between-subjects vs. Within-subjects Design:

    • Consider whether a between-subjects design (comparing different strains) or within-subjects design (comparing the same strain under different conditions) is more appropriate

    • For yhjU characterization, a factorial design testing multiple strains under various growth conditions often provides the most comprehensive data

This control strategy minimizes the risk of misinterpreting results due to off-target effects, technical variability, or inherent biological noise.

What troubleshooting strategies should I employ when purification of recombinant yhjU yields inconsistent results?

When facing inconsistent purification results with recombinant yhjU, implement this systematic troubleshooting approach:

  • Expression Level Verification:

    • Confirm consistent expression levels across batches using western blot

    • Check for degradation products that may indicate instability

    • Verify the integrity of the expression construct by sequencing

  • Solubilization Optimization:

    • For membrane proteins like yhjU, test multiple detergents (DDM, LDAO, MNG)

    • Screen detergent concentrations systematically (0.5-2% for extraction, 1-3× CMC for purification)

    • Consider adding stabilizing agents (glycerol, specific lipids, salt)

  • Purification Condition Refinement:

    • Test buffer pH range (typically pH 7.0-8.5 in 0.5 increments)

    • Optimize salt concentration (typically 100-500 mM NaCl)

    • Include reducing agents if the protein contains cysteines (DTT, BME, TCEP)

  • Column Selection and Protocol Optimization:

    • For His-tagged proteins, compare Ni-NTA, TALON, and Ni-IDA resins

    • Test batch binding versus column chromatography

    • Optimize imidazole concentrations in wash and elution buffers

  • Process Standardization:

    • Maintain consistent cell disruption methods (sonication, homogenization)

    • Standardize centrifugation speeds and times

    • Use the same buffer lots and preparation protocols

  • Stability Enhancement During Purification:

    • Keep samples cold (4°C) throughout the process

    • Add protease inhibitors freshly to each buffer

    • Consider adding stabilizing ligands if known

Documenting each variable in a systematic manner will help identify the critical factors affecting purification consistency.

How can I design experiments to distinguish between direct and indirect effects of yhjU on cellular metabolism?

To differentiate between direct and indirect effects of yhjU on cellular metabolism, implement this multi-level experimental design:

  • In Vitro Biochemical Assays:

    • Purify recombinant yhjU protein to homogeneity

    • Test direct enzymatic activity on suspected substrates

    • Measure binding affinities with potential interaction partners

    • Reconstitute minimal systems with defined components

  • Temporal Analysis:

    • Perform time-course experiments after induction or repression of yhjU

    • Immediate effects (minutes to hours) suggest direct involvement

    • Delayed effects (hours to days) suggest indirect regulatory roles

    • Use metabolic flux analysis at different time points

  • Dose-Response Relationships:

    • Create strains with titratable yhjU expression

    • Correlate yhjU levels with phenotypic outcomes

    • Direct effects typically show proportional responses

  • Genetic Bypass Experiments:

    • Identify suppressor mutations that restore function in ΔyhjU strains

    • Test if overexpression of specific pathway components can compensate for yhjU deletion

    • Construct synthetic pathways that bypass the need for yhjU

  • Targeted Metabolomics:

    • Compare metabolite profiles between wild-type and ΔyhjU strains

    • Focus on specific pathways suggested by preliminary data

    • Use stable isotope labeling to track carbon flux through specific pathways

  • Structure-Function Analysis:

    • Create point mutations in catalytic or binding domains

    • Assess which protein features are essential for function

    • Correlate structural changes with metabolic effects

This comprehensive approach provides multiple lines of evidence to distinguish direct enzymatic or binding effects from indirect regulatory functions.

What statistical approaches are most appropriate for analyzing metabolomics data from yhjU knockout experiments?

When analyzing metabolomics data from yhjU knockout experiments, employ these statistical approaches for robust interpretation:

How can I integrate transcriptomic, proteomic, and metabolomic data to gain comprehensive insights into yhjU function?

To effectively integrate multi-omics data for understanding yhjU function, implement this systematic workflow:

  • Data Preprocessing and Normalization:

    • Standardize each data type independently using appropriate normalization methods

    • For transcriptomics: TPM/RPKM normalization, batch correction

    • For proteomics: Total ion current normalization, LOESS regression

    • For metabolomics: Internal standard normalization, probabilistic quotient normalization

  • Initial Independent Analysis:

    • Analyze each omics layer separately to identify significant changes

    • Create ranked lists of differentially expressed genes, proteins, and metabolites

    • Generate pathway enrichment results for each data type

  • Cross-Platform Data Integration:

    • Correlation-based approaches: Calculate Pearson/Spearman correlations between omics layers

    • Pathway-based integration: Map all data types to common pathways using KEGG or BioCyc

    • Network-based methods: Construct interaction networks incorporating all data types

    • Multi-block statistical methods: DIABLO, MOFA, or Joint and Individual Variation Explained (JIVE)

  • Causal Inference:

    • Use Bayesian networks to infer causal relationships

    • Implement time-course experiments to establish temporal order of events

    • Apply intervention calculus to determine the impact of yhjU on identified networks

  • Biological Interpretation Tools:

    • OmicsBox or similar platforms for visual integration of multiple omics layers

    • ConsensusPathDB for integrating interaction networks

    • MixOmics R package for statistical integration of multi-omics data

  • Validation Experiments:

    • Design targeted experiments to validate key findings

    • Focus on nodes that show consistency across multiple omics layers

    • Use orthogonal techniques to confirm critical interactions

This integrated approach provides a systems-level understanding of yhjU function that no single omics approach could achieve independently.

What comparative genomics approaches can help predict the function of yhjU?

To leverage comparative genomics for predicting yhjU function, implement these sophisticated approaches:

  • Phylogenetic Profiling:

    • Map the presence/absence of yhjU orthologs across diverse bacterial species

    • Identify proteins with similar phylogenetic profiles, suggesting functional relationships

    • Calculate mutual information between profiles to quantify associations

  • Genomic Context Analysis:

    • Examine the conserved gene neighborhood around yhjU across species

    • Identify operonic structures and common gene clusters

    • Analyze promoter regions for conserved regulatory elements

  • Domain Architecture Analysis:

    • Identify conserved domains in yhjU using tools like Pfam, SMART, or InterPro

    • Search for proteins with similar domain architectures

    • Analyze domain fusion events that may suggest functional relationships

  • Evolutionary Rate Analysis:

    • Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS)

    • Identify conserved residues which may be functionally critical

    • Detect signatures of positive selection that might indicate adaptive functions

  • Co-evolution Analysis:

    • Identify proteins showing correlated evolutionary patterns with yhjU

    • Apply methods like mutual information or direct coupling analysis

    • Predict physical interactions based on co-evolutionary signatures

  • Cross-Species Expression Correlation:

    • Compare expression patterns of yhjU orthologs across species

    • Identify consistently co-expressed genes across evolutionary distance

    • Integrate with other comparative approaches for functional inference

These approaches, when integrated, provide multiple lines of evidence for functional prediction, particularly valuable for uncharacterized proteins like yhjU.

How should I design experiments to determine if yhjU function is condition-dependent?

To systematically investigate potential condition-dependent functions of yhjU, implement this comprehensive experimental design:

  • Growth Condition Matrix:

    • Carbon sources: Test growth on glucose, glycerol, lactate, formate, and acetate

    • Oxygen availability: Compare aerobic, microaerobic, and anaerobic conditions

    • pH ranges: Test acidic, neutral, and alkaline environments

    • Osmotic stress: Vary salt concentrations to induce osmotic pressure

    • Temperature: Test standard (37°C), heat stress (42°C), and cold stress (25°C)

  • Experimental Setup:

    • Strain preparation: Compare wild-type, ΔyhjU, and complemented strains

    • Control strains: Include knockout strains of similar proteins (e.g., ΔyhjY)

    • Replication: Minimum of three biological replicates per condition

    • Randomization: Randomize sample processing to avoid batch effects

  • Multi-parameter Phenotyping:

    • Growth kinetics: Measure growth rates and lag phases in each condition

    • Stress response: Assess survival under acute stress conditions

    • Metabolite production: Measure key metabolites like formate and hydrogen

    • Gene expression: Monitor yhjU expression across conditions

  • Statistical Analysis Design:

    • Use factorial design to identify interaction effects between conditions

    • Apply two-way ANOVA to determine significant condition-dependent effects

    • Implement appropriate multiple testing corrections

  • Data Visualization:

    • Create heatmaps showing phenotypic differences across conditions

    • Use principal component analysis to visualize major patterns

    • Develop network visualizations showing condition-specific interactions

This systematic approach will reveal whether yhjU has distinct functions under different environmental conditions, potentially explaining conflicting results observed in previous studies.

What approaches can I use to identify potential ligands or substrates of yhjU?

To identify potential ligands or substrates of the uncharacterized protein yhjU, implement these complementary experimental approaches:

  • In Silico Prediction Methods:

    • Structure-based virtual screening: Generate homology models and dock potential ligands

    • Binding site prediction: Analyze protein surface for potential binding pockets

    • Sequence-based prediction: Compare with proteins of known function and substrate specificity

  • Thermal Shift Assays (Differential Scanning Fluorimetry):

    • Screen compound libraries for molecules that stabilize yhjU protein

    • Measure shifts in melting temperature (Tm) indicating ligand binding

    • Test metabolites from pathways implicated in uncharacterized protein studies

  • Metabolite Profiling:

    • Compare metabolomic profiles between wild-type and ΔyhjU strains

    • Focus on accumulated metabolites in knockout strains (potential substrates)

    • Analyze depleted metabolites in knockout strains (potential products)

  • Activity-Based Protein Profiling:

    • Use chemical probes that react with specific enzyme classes

    • Determine if yhjU binds to probes targeting specific enzymatic activities

    • Identify active site residues through differential labeling

  • Biochemical Activity Screening:

    • Test enzymatic activity with substrate classes suggested by bioinformatics

    • Screen for hydrogen metabolism-related activities based on findings from related proteins

    • Implement high-throughput colorimetric or fluorometric assays

  • Binding Assays:

    • Isothermal Titration Calorimetry (ITC): Directly measure binding thermodynamics

    • Surface Plasmon Resonance (SPR): Determine binding kinetics

    • Microscale Thermophoresis (MST): Measure binding in solution with minimal protein requirements

  • Crosslinking Mass Spectrometry:

    • Use photoactivatable or chemical crosslinkers to capture transient interactions

    • Identify bound metabolites or proteins by mass spectrometry

    • Employ in vivo crosslinking to capture physiologically relevant interactions

This multifaceted approach provides multiple lines of evidence to identify the true substrates or ligands of yhjU.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.