Recombinant Escherichia coli Uncharacterized protein yidX (yidX)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

The yidX gene (accession: EG11719) encodes a 218-amino-acid polypeptide (UniProt ID: P0ADM6) localized to the inner membrane of E. coli . Key attributes include:

AttributeDetails
Gene Locusb3696, JW5858
Protein Length218 amino acids (aa 1–218)
Molecular Weight~24.7 kDa (calculated)
Subcellular LocalizationInner membrane
Putative FunctionLipoprotein (hypothetical)

Bioinformatics analyses suggest yidX may belong to a family of bacterial lipoproteins, though its exact biochemical role remains undefined .

Recombinant Protein Production

The recombinant yidX protein is typically expressed in E. coli expression systems and purified to >90% homogeneity via chromatography. Key production parameters include:

ParameterDetails
Expression HostE. coli (BL21(DE3) or similar strains)
Purification TagN-terminal His-tag (6xHis)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

The recombinant protein’s sequence matches the native E. coli yidX, as confirmed by SDS-PAGE and mass spectrometry .

Research Applications

Recombinant yidX is utilized in diverse research contexts:

Vaccine Development

Creative Biolabs highlights its potential in vaccine formulations, though direct evidence for immunogenicity is limited .

Comparative Pathway Analysis

Bioinformatics tools (e.g., BioCyc) associate yidX with pathways involving membrane integrity and stress response, though experimental validation is pending .

Key Research Gaps and Future Directions

  1. Functional Characterization: No studies explicitly define yidX’s role in E. coli physiology.

  2. Structural Insights: Crystallization efforts or cryo-EM studies are required to map interactions with membrane components.

  3. Pathogenic Relevance: Potential involvement in virulence or antimicrobial resistance remains unexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yidX; b3696; JW5858; Uncharacterized protein YidX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yidX
Target Protein Sequence
MKLNFKGFFKAAGLFPLALMLSGCISYALVSHTAKGSSGKYQSQSDTITGLSQAKDSNGT KGYVFVGESLDYLITDGADDIVKMLNDPALNRHNIQVADDARFVLNAGKKKFTGTISLYY YWNNEEEKALATHYGFACGVQHCTRSLENLKGTIHEKNKNMDYSKVMAFYHPFKVRFYEY YSPRGIPDGVSAALLPVTVTLDIITAPLQFLVVYAVNQ
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW5858

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Escherichia coli Uncharacterized protein yidX (yidX)?

Recombinant Escherichia coli Uncharacterized protein yidX (yidX) is a protein encoded by the yidX gene in E. coli whose function has not been fully characterized. This protein belongs to the group of hypothetical or uncharacterized proteins identified within the E. coli genome sequence but lacking experimental validation of their biological roles. The recombinant form refers to the protein produced through genetic engineering techniques where the yidX gene is cloned into an expression vector and introduced into a host system for protein production. Studying such uncharacterized proteins is critical for fully understanding E. coli biology, as they may represent novel functional pathways or adaptations that are not yet documented in the scientific literature .

How does yidX fit within the broader E. coli genome and proteome landscape?

The yidX protein represents one of many uncharacterized proteins in the E. coli pan-genome, which encompasses over 10,000 sequenced E. coli strains. Within this extensive genomic landscape, yidX may be either a core protein present across many E. coli lineages or a more specialized protein found in specific strains or pathotypes. Its genomic context—including neighboring genes, regulatory elements, and conservation across different E. coli lineages—can provide initial clues to its potential function. Comparative genomic analysis across the comprehensive E. coli genome collection can reveal whether yidX shows patterns of co-occurrence with genes of known function, potentially indicating its participation in specific cellular processes or metabolic pathways .

What expression systems are most suitable for producing recombinant yidX protein?

When selecting an expression system for recombinant yidX protein production, researchers must consider factors including protein solubility, post-translational modifications, and downstream applications. Below is a comparison of expression systems commonly used for E. coli proteins:

Expression SystemAdvantagesDisadvantagesTypical YieldBest Applications
E. coli BL21(DE3)High yield, simple protocol, cost-effectiveLimited post-translational modifications, potential for inclusion bodies10-100 mg/LStructural studies, biochemical assays
E. coli Rosetta strainsOptimized for rare codons, better for proteins with codon biasHigher cost than standard strains5-50 mg/LProteins with rare codon usage
E. coli SHuffle/OrigamiEnhanced disulfide bond formationSlower growth, lower yields2-20 mg/LProteins requiring disulfide bonds
Yeast systemsSome eukaryotic post-translational modificationsMore complex protocols5-50 mg/LProteins requiring glycosylation
Baculovirus-insect cellComplex eukaryotic modificationsExpensive, technically demanding1-10 mg/LComplex proteins, membrane proteins

The optimal choice depends on the specific research goals, with E. coli-based systems typically providing the highest yields for bacterial proteins like yidX .

What are the key considerations for designing primers for yidX cloning?

When designing primers for yidX cloning, several factors must be considered to ensure successful amplification and subsequent protein expression. First, primers should include appropriate restriction enzyme sites that are compatible with your chosen expression vector but absent from the yidX gene sequence. Include 4-6 nucleotides flanking the restriction sites to ensure efficient enzyme digestion. If expressing with an affinity tag, ensure the tag is in-frame with the coding sequence, and consider adding a protease cleavage site if tag removal will be necessary. For improved expression, optimize the Kozak sequence or ribosome binding site based on your expression system. If mutagenesis studies are planned, design primers with sufficient homology (25-30 bp) flanking the mutation site. Analyze all primers for secondary structures, self-complementarity, and appropriate GC content (40-60%) to ensure efficient amplification .

What experimental approaches are most effective for characterizing yidX function?

Characterizing the function of an uncharacterized protein like yidX requires a multifaceted experimental approach. The following table outlines key methodologies in order of implementation:

ApproachInformation ObtainedTechnical ComplexityTimelineKey Considerations
Bioinformatic analysisPredicted function, domains, evolutionary relationshipsLowDaysEffectiveness depends on existence of characterized homologs
Gene knockout/knockdownPhenotypic effects, in vivo relevanceMediumWeeksMay show no phenotype if functional redundancy exists
Complementation studiesConfirmation of function, strain-specific effectsMediumWeeksRequires knockout strain, careful expression control
Protein-protein interactionsBinding partners, complex formationMedium-HighWeeks-MonthsMultiple methods with different sensitivity/specificity profiles
Biochemical assaysSpecific activities, substrate preferencesMedium-HighWeeksRequires purified active protein
Structural studies3D structure, mechanism insightsHighMonths-YearsResource-intensive but highly informative
Multi-omics integrationSystems-level function, regulatory networksHighMonthsRequires computational expertise, large datasets

A thorough characterization typically begins with bioinformatic predictions that inform the design of subsequent wet-lab experiments. The experimental design should include appropriate controls, replication, and statistical analyses to ensure robust findings .

How should contradictions in yidX characterization data be analyzed and resolved?

When faced with contradictory results in yidX characterization studies, a systematic approach to analysis and resolution is essential. First, document all experimental variables that differ between contradictory studies, including expression constructs (tags, fusion partners), buffer compositions, experimental conditions (temperature, pH, salt concentration), and analytical methods. Create a comparative table highlighting these differences to identify potential sources of discrepancy. Consider whether apparent contradictions might represent condition-dependent behavior rather than genuine inconsistencies. Design validation experiments that specifically address the contradictory findings, incorporating controls that distinguish between competing hypotheses. If protein activity is involved, verify that all protein preparations retain structural integrity through circular dichroism, thermal shift assays, or size exclusion chromatography. Statistical analysis should include power calculations to ensure adequate sample sizes and appropriate statistical tests with correction for multiple comparisons .

What controls are essential when designing experiments to study yidX interactions?

When designing experiments to study yidX interactions, incorporating appropriate controls is crucial for generating reliable and interpretable data. Essential controls include: (1) Empty vector controls during protein expression to distinguish background proteins from your target; (2) Non-specific binding controls such as unrelated proteins of similar size and properties; (3) Known interactor controls—proteins with established interaction partners to validate your experimental system; (4) Negative interaction controls—proteins known not to interact with your target; (5) Concentration gradients to establish dose-dependency of observed interactions; (6) Competition assays with unlabeled protein to confirm specificity; (7) Tag-only controls to exclude tag-mediated interactions; and (8) Buffer composition controls to determine the effect of experimental conditions on interaction stability. Additionally, include both technical replicates (same biological sample, repeated measurements) and biological replicates (independent biological samples) to assess reproducibility and biological variability. These controls help distinguish genuine biological interactions from technical artifacts .

How can researchers optimize expression conditions for recombinant yidX?

Optimizing expression conditions for recombinant yidX requires systematic testing of multiple parameters to maximize yield and solubility. Begin with small-scale expression trials comparing different E. coli strains (BL21(DE3), Rosetta, Arctic Express), media formulations (LB, TB, auto-induction), and induction parameters. The temperature, inducer concentration, and induction duration significantly impact protein folding and solubility—lower temperatures (16-25°C) often improve solubility at the expense of total yield. If initial screens show poor solubility, test various fusion tags (His, GST, MBP, SUMO) that can enhance solubility. Consider co-expression with molecular chaperones for proteins prone to misfolding. For membrane-associated proteins, specialized detergents or membrane-mimetic systems may be necessary. Document expression levels through both SDS-PAGE analysis and activity assays to ensure optimization yields functional protein. Once optimal conditions are established at small scale, validate the protocol at larger scales to ensure consistent results during scale-up .

How can bioinformatic approaches predict potential functions for yidX?

Bioinformatic approaches offer powerful tools for predicting potential functions of uncharacterized proteins like yidX. Sequence-based methods include homology detection using PSI-BLAST, HHpred, or HMMER to identify distant relatives with known functions. Domain prediction tools such as InterPro, Pfam, or SMART can identify conserved functional domains. Structure prediction through AlphaFold2 or I-TASSER can reveal structural similarities to characterized proteins even in the absence of sequence similarity, while molecular docking can predict interactions with potential ligands or substrates. Genomic context analysis examines neighboring genes, as functionally related genes often cluster together in bacterial genomes. Gene co-expression networks identify genes with similar expression patterns across conditions, suggesting functional relationships. These approaches can be integrated using machine learning algorithms to generate weighted functional predictions. The E. coli pan-genome collection provides an extensive database for comparative genomic analyses, enabling examination of yidX conservation patterns across diverse strains and ecological niches .

What strategies are effective for studying potential post-translational modifications of yidX?

While E. coli has fewer post-translational modifications (PTMs) than eukaryotes, bacterial proteins can undergo modifications including phosphorylation, acetylation, methylation, and proteolytic processing that significantly impact function. To study potential PTMs of yidX, begin with bioinformatic prediction using tools specific for bacterial modifications (e.g., NetPhosBac for phosphorylation sites). For experimental detection, mass spectrometry-based proteomics is the gold standard, with enrichment strategies for specific modifications improving detection sensitivity. Compare modifications under different growth conditions to reveal regulatory patterns—for example, phosphorylation often changes in response to environmental stresses. Site-directed mutagenesis of putative modification sites, replacing modifiable residues with non-modifiable variants, can demonstrate the functional significance of specific PTMs. For phosphorylation, phosphomimetic mutations (e.g., serine to aspartate) can simulate the constitutively phosphorylated state. Additionally, in vitro modification assays using purified kinases or acetyltransferases can confirm modification potential and identify the responsible enzymes .

How should researchers approach the study of yidX in the context of E. coli strain diversity?

The extreme genomic diversity among E. coli strains presents both challenges and opportunities for studying proteins like yidX. With over 10,000 sequenced strains spanning commensal, pathogenic, and environmental isolates, researchers must consider strain variation in their experimental design. Begin by examining yidX conservation across the E. coli pan-genome to determine if it's part of the core genome (present in all strains) or the accessory genome (present in only some lineages). Sequence alignment of yidX homologs can reveal conserved residues likely crucial for function, while strain-specific variations may indicate adaptations to particular niches. If yidX shows lineage-specific distribution, correlation with specific phenotypes or ecological niches may provide functional clues. For functional studies, consider testing phenotypes in multiple strain backgrounds to assess whether function is strain-dependent. The comprehensive E. coli genome collection provides a valuable resource for identifying suitable strains for comparative studies, while also offering contextual information about gene neighborhoods and evolutionary patterns .

What approaches can determine if yidX forms part of a larger protein complex?

Determining whether yidX participates in protein complexes requires multiple complementary approaches. Begin with affinity purification coupled with mass spectrometry (AP-MS), where tagged yidX is used as bait to capture interacting partners. Blue native PAGE can resolve intact complexes while preserving native interactions. Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS) provides information about complex size and stoichiometry. Crosslinking mass spectrometry (XL-MS) can capture transient or weak interactions by covalently linking proteins in close proximity before analysis. For in vivo studies, bacterial two-hybrid systems or split-reporter assays can validate specific interactions, while proximity labeling approaches like BioID can identify proteins in the vicinity of yidX within living cells. Co-immunoprecipitation with antibodies against suspected interaction partners provides direct evidence of complex formation. Throughout these studies, controls for non-specific binding are essential, as are validation experiments confirming biological relevance, such as demonstrating co-occurrence of phenotypes when complex components are individually disrupted .

What statistical approaches are appropriate for analyzing yidX interaction data?

Statistical analysis of protein interaction data requires approaches tailored to the specific experimental method used. For binary interaction data (presence/absence), Fisher's exact test or chi-square tests determine significance of enrichment compared to control samples. For quantitative interaction data from affinity purification mass spectrometry, specialized tools like SAINT (Significance Analysis of INTeractome) or CompPASS (Comparative Proteomics Analysis Software Suite) distinguish true interactors from background contaminants by comparing test samples against multiple controls. For spectral count data, negative binomial models often provide appropriate statistical frameworks. When evaluating numerous potential interactions simultaneously, multiple testing correction is essential, with methods such as Benjamini-Hochberg controlling false discovery rates. For all interaction studies, establish clear significance thresholds based on both statistical significance (typically p < 0.05 or FDR < 0.1) and effect size (fold enrichment over background). Visualization through volcano plots effectively highlights interactions that meet both statistical significance and fold-change criteria. Regardless of the statistical approach, biological replicates (minimum three) are essential for robust analysis .

How can researchers integrate yidX findings with broader E. coli proteome studies?

Integrating yidX findings with broader E. coli proteome studies requires strategies that place individual protein data within systemic contexts. Network integration approaches can position yidX within known protein-protein interaction networks, metabolic pathways, or regulatory circuits. Multi-omics data integration combines proteomics with transcriptomics, metabolomics, and genomics to provide a comprehensive view of yidX's role. Correlation analysis across multiple datasets can reveal functional associations not apparent in single-dataset analyses. Functional enrichment analysis identifies biological processes, molecular functions, or cellular components associated with yidX and its interaction partners. For data integration, standardize formats and identifiers across datasets, and consider using Bayesian integration frameworks that account for varying reliability between data types. The comprehensive E. coli genome collection provides an excellent backbone for integration efforts, allowing researchers to examine yidX within diverse genetic backgrounds and environmental contexts. Public resources like STRING, EcoCyc, and UniProt offer additional contexts for interpretation, while visualization tools like Cytoscape enable exploration of integrated networks .

What visualization techniques best represent yidX interaction networks?

Effective visualization of protein interaction networks can reveal patterns and relationships not immediately apparent in tabular data. For yidX interaction networks, the visualization approach should be tailored to the complexity and research objectives. For direct interaction partners, spoke diagrams clearly display first-level interactions. For more complex networks, force-directed layouts position nodes based on connection strength, revealing natural clusters of functionally related proteins. Hierarchical layouts effectively display regulatory relationships or pathway connections. Color coding nodes by functional category, subcellular localization, or expression level adds contextual dimensions to the visualization. Edge attributes can represent interaction strength, detection method, or confidence scores through varying thickness, style, or color. For temporal data, dynamic visualizations showing network evolution across conditions or time points can reveal regulatory patterns. All visualizations should include appropriate legends, scale information, and statistical significance indicators. Cytoscape represents the gold standard tool for network visualization, offering numerous layout algorithms and customization options, along with plugins for functional enrichment analysis and integration with public databases .

What purification strategies are most effective for obtaining high-quality yidX protein?

Purification of recombinant yidX requires a strategy tailored to its physicochemical properties and downstream applications. After optimizing expression conditions, begin with affinity chromatography matching your fusion tag—Immobilized Metal Affinity Chromatography (IMAC) for His-tagged proteins or glutathione affinity for GST-fusion proteins. This initial purification should be followed by at least one orthogonal method to achieve high purity. Ion exchange chromatography (selecting cation or anion exchange based on yidX's isoelectric point) effectively removes contaminants with different charge properties, while size exclusion chromatography separates by molecular size, removing aggregates and providing information about oligomeric state. Throughout purification, monitor protein stability and optimize buffer conditions (pH, salt concentration, additives) to prevent aggregation or degradation. Thermal shift assays can rapidly screen buffer conditions for optimal stability. For membrane-associated proteins, detergent selection is critical—start with mild detergents like DDM or LMNG. Evaluate purification success using multiple methods: SDS-PAGE for purity, Western blotting for identity, dynamic light scattering for homogeneity, and activity assays for functionality. Document yield at each step to identify and optimize bottlenecks in the purification process .

What in vitro assays can help determine the biochemical function of yidX?

Determining the biochemical function of an uncharacterized protein like yidX requires hypothesis-driven experimental design informed by bioinformatic predictions. If sequence analysis suggests enzymatic activity, activity-based screening assays can test catalytic function against panels of potential substrates. Common screens include testing for hydrolase activity (using fluorogenic or chromogenic substrates), kinase activity (using ATP consumption assays), or oxidoreductase activity (using electron transfer detection systems). For potential DNA/RNA binding proteins, electrophoretic mobility shift assays, filter binding assays, or fluorescence anisotropy can characterize nucleic acid interactions. Protein-protein interaction studies might employ surface plasmon resonance, isothermal titration calorimetry, or microscale thermophoresis to quantify binding parameters. If membrane association is predicted, liposome binding assays or reconstitution into nanodiscs might be appropriate. When function remains entirely unknown, broader approaches such as metabolite array screening, thermal proteome profiling, or activity-based protein profiling can provide functional clues. Design all assays with appropriate positive and negative controls, and include titrations to establish dose-dependency .

How should researchers design mutagenesis studies to probe yidX function?

Strategic mutagenesis studies can provide critical insights into protein function by establishing structure-function relationships. Begin with bioinformatic analysis to identify conserved residues across homologs, predicted active sites, or potential binding interfaces that warrant investigation. Design mutations that test specific hypotheses about protein function: alanine substitutions remove side chain functionality while maintaining structure; conservative substitutions (e.g., aspartate to glutamate) test the importance of specific properties like side chain length; and radical substitutions (e.g., changing charge or hydrophobicity) can drastically alter local properties. Site-directed mutagenesis using PCR-based methods efficiently generates these variants. Express and purify mutant proteins in parallel with wild-type controls, carefully assessing expression levels, solubility, and stability to distinguish mutations affecting protein folding versus those specifically impacting function. Subject each mutant to the same functional assays as the wild-type protein, quantifying differences in activity, binding, or other relevant parameters. For comprehensive analysis, consider creating libraries of random mutants followed by selection or screening for altered function. Interpret results in the context of structural models or predictions, with mutations causing similar phenotypes potentially identifying functional motifs or interaction surfaces .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.