Recombinant Escherichia coli Uncharacterized protein yjhP (yjhP)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Sequence

The yjhP protein (UniProt ID: P39367) is a full-length transmembrane protein with an N-terminal 10xHis-tag for purification . Its amino acid sequence is:
MDIPRIFTISESEHRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTW ARDHGI TGTGIDMSSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFA GAEELLAQSLKPGGIMLIGEPYWRQLPATEEIAQACGVSSTSDFLTLPGLVGAFDDLGYD VVEMVLADQEGWDRYEAAKWLTMRRWLEANPDDDFAAEVRAELNIAPKRYVTYARECFGW GVFALIAR .

FeatureDetail
Length248 amino acids
TagN-terminal 10xHis-tag
SourceE. coli (strain K12)
Transmembrane DomainsPredicted (exact topology unconfirmed)
Sequence HomologyLimited to E. coli strains; no known homologs in other species

Production and Purification

yjhP is produced via recombinant expression in E. coli using optimized systems. Key parameters include:

ParameterDetail
Expression SystemE. coli (commonly BL21(DE3) or similar strains)
InductionTypically IPTG (isopropyl β-D-1-thiogalactopyranoside)
Purity>90% (SDS-PAGE validated)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
BufferTris/PBS-based with 6% trehalose (pH 8.0)

Functional Insights and Predicted Roles

Despite lacking direct experimental validation, bioinformatic analyses suggest potential roles:

Predicted FunctionSupporting Evidence
Methylation-RelatedCo-occurrence with methyltransferases (yafE, yjtD)
Sialic Acid MetabolismProximity to nanS, which regulates 9-O-acetyl-N-acetylneuraminate
Transmembrane ActivityStructural prediction of membrane-spanning domains

Notably, yjhP is part of the yjhBC operon, though its relationship to YjhC (a sialic acid-degrading oxidoreductase ) remains unclear.

Challenges and Future Directions

  • Functional Elucidation: No direct evidence links yjhP to enzymatic activity or metabolic pathways.

  • Expression Optimization: E. coli systems may require strain engineering to enhance solubility or reduce inclusion body formation .

  • Cross-Domain Studies: Further investigation into interactions with ribosomal proteins or regulatory factors (e.g., CsrA) could reveal novel roles .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yjhP; b4306; JW4268; Uncharacterized protein YjhP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yjhP
Target Protein Sequence
MDIPRIFTISESEHRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTWARDHGI TGTGIDMSSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFA GAEELLAQSLKPGGIMLIGEPYWRQLPATEEIAQACGVSSTSDFLTLPGLVGAFDDLGYD VVEMVLADQEGWDRYEAAKWLTMRRWLEANPDDDFAAEVRAELNIAPKRYVTYARECFGW GVFALIAR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What defines yjhP as an "uncharacterized protein" in E. coli?

Uncharacterized or hypothetical proteins (HPs) like yjhP are proteins predicted to be expressed from an open reading frame but lack properly defined functions . These proteins are classified as "uncharacterized" when they meet several criteria:

  • Absence of significant homology to proteins with experimentally verified functions

  • Lack of experimental characterization through biochemical or genetic approaches

  • Unknown three-dimensional structure

  • Undefined cellular localization and interaction partners

According to current research, hypothetical proteins constitute a substantial fraction of proteomes in both prokaryotes and eukaryotes . For E. coli specifically, while genomic sequencing has identified the yjhP gene, its precise biological role remains undetermined through experimental validation.

What bioinformatic approaches are recommended for initial characterization of yjhP?

Initial characterization of uncharacterized proteins like yjhP should employ a comprehensive suite of bioinformatic tools that can provide insights into potential function:

Analysis TypeRecommended ToolsExpected Outcomes
Sequence AnalysisBLAST, Pfam, CDD, InterProHomology detection, domain identification
Physicochemical PropertiesExPASy ProtParamMolecular weight, pI, instability index, GRAVY values
Subcellular LocalizationPSORTb, SignalPPrediction of cellular compartment, secretory nature
Structure PredictionAlphaFold, I-TASSER3D structural models, potential binding sites
Functional NetworksSTRINGPredicted protein-protein interactions

For uncharacterized proteins, analyzing the instability index (II) can provide insights into protein stability, with values below 40 typically indicating stable proteins. The GRAVY (Grand Average of Hydropathy) value indicates polarity, with negative values suggesting non-polar nature .

Additionally, specialized analyses such as identification of antimicrobial resistance genes, detection of prophage sequences, CRISPR-Cas9 system analysis, and virulence factor identification can further enhance functional predictions .

How can genomic context analysis contribute to understanding yjhP function?

Genomic context analysis is an essential approach for generating functional hypotheses for uncharacterized proteins:

  • Operon structure: Determining if yjhP is part of an operon provides insights into functional relationships, as bacterial genes in the same operon often participate in related processes.

  • Synteny analysis: Examining the conservation of gene order surrounding yjhP across different bacterial species can indicate functional importance.

  • Regulatory elements: Identification of transcription factor binding sites upstream of yjhP can suggest conditions under which it is expressed.

  • Phylogenetic profiling: Analyzing the co-occurrence patterns of yjhP with other genes across multiple genomes can reveal functional associations.

These approaches leverage the principle that bacterial genes with related functions tend to be organized together in the genome and are often co-regulated. By examining the genomic neighborhood of yjhP across multiple E. coli strains and related bacteria, researchers can generate testable hypotheses about its potential role in specific cellular processes.

What expression systems optimize recombinant production of yjhP in E. coli?

Efficient expression of uncharacterized proteins like yjhP requires optimization of multiple parameters:

Vector and Strain Selection:

  • Expression vectors: pET series vectors with T7 promoter provide high-level expression; pBAD vectors offer tighter regulation

  • Host strains: BL21(DE3) for general expression; Rosetta strains for rare codon optimization; C41/C43 for potentially toxic proteins

Expression Conditions:

  • Temperature optimization: Testing expression at 37°C, 30°C, and 18°C, with lower temperatures often improving protein folding

  • Induction parameters: IPTG concentration (typically 0.2 mM) and induction timing (at OD600 of 0.5-0.7)

  • Duration: Expression for 3-20 hours depending on protein stability

Solubility Enhancement:

  • Fusion tags: MBP, GST, or SUMO tags can dramatically improve solubility of recalcitrant proteins

  • Chaperone co-expression: GroEL/ES or DnaK/J systems to assist proper folding

  • Lysis buffer optimization: Addition of stabilizing agents (glycerol, trehalose) or detergents

For uncharacterized proteins like yjhP, empirical testing of multiple expression conditions is crucial, as their behavior can be difficult to predict from sequence alone.

What purification strategies are most effective for recombinant yjhP?

Purification of uncharacterized proteins requires a strategic approach combining multiple techniques:

Primary Capture:

  • Affinity chromatography: His-tag purification using Ni-NTA or TALON resins provides efficient initial capture

  • Fusion protein approaches: GST-fusion or MBP-fusion systems for enhanced solubility and affinity purification

Secondary Purification:

  • Ion exchange chromatography: Based on the predicted pI of yjhP (derived from bioinformatic analysis)

  • Size exclusion chromatography: For final polishing and buffer exchange

  • Tag removal: Incorporation of protease cleavage sites (TEV, PreScission) between the tag and yjhP

Optimization Considerations:

  • Buffer composition based on predicted physicochemical properties

  • Addition of stabilizing agents during purification

  • Assessment of protein quality by SDS-PAGE, Western blotting, and mass spectrometry

For bacterial proteins like yjhP, cell lysis by sonication or French press followed by centrifugation (typically at 4000 rpm, 4°C for 20 min) provides effective initial fractionation . The subcellular localization prediction from PSORTb can guide fractionation approaches, as proteins may be cytoplasmic, membrane-associated, or extracellular .

What proteomics approaches enable functional characterization of yjhP?

Proteomic analysis of uncharacterized proteins like yjhP requires careful sample preparation and analytical techniques:

Sample Preparation:

  • Cell lysis and fractionation: Separation of soluble and insoluble fractions

  • Protein solubilization: Using appropriate detergents and buffer systems

  • Protein separation: 2D gel electrophoresis using immobilized pH gradients (IPGs) followed by SDS-PAGE

Mass Spectrometry Analysis:

  • Protein identification: MALDI-TOF or LC-MS/MS for confirming yjhP expression

  • Post-translational modifications: Identification of potential regulatory modifications

  • Protein-protein interactions: Immunoprecipitation or crosslinking coupled with MS

Comparative Proteomics:

  • Expression profiling: Comparing yjhP expression under different conditions

  • Interactome analysis: Identifying proteins that co-purify with tagged yjhP

  • Structural proteomics: Limited proteolysis coupled with MS to probe structural features

The combination of 2D gel electrophoresis with mass spectrometry represents the core technology for detailed proteomic characterization, allowing for separation and parallel quantitative expression profiling of complex protein mixtures .

How can structural prediction enhance functional understanding of yjhP?

Structural prediction offers critical insights into the potential function of uncharacterized proteins like yjhP:

Structural Analysis Workflow:

  • Secondary structure prediction to identify alpha-helices, beta-sheets, and disordered regions

  • Tertiary structure modeling using homology modeling or ab initio prediction methods

  • Model quality assessment and refinement

  • Binding site and active site prediction

Functional Insights from Structure:

  • Identification of structural motifs shared with characterized proteins

  • Detection of potential catalytic sites through spatial arrangement of conserved residues

  • Recognition of binding pockets that can suggest interaction partners or substrates

  • Analysis of surface properties (electrostatic potential, hydrophobicity) to predict function

Experimental Validation Based on Structure:

  • Site-directed mutagenesis of predicted functional residues

  • Ligand binding studies targeting predicted binding pockets

  • Structural comparison with proteins of known function

For uncharacterized proteins, structural features often provide more reliable functional hints than sequence alone, especially when sequence homology to characterized proteins is limited.

What approaches best elucidate protein-protein interactions involving yjhP?

Understanding interaction partners provides critical context for uncharacterized proteins:

In Vivo Interaction Methods:

  • Bacterial two-hybrid system: Adapted for detecting protein interactions in bacterial cells

  • Co-immunoprecipitation: Pulling down complexes containing tagged yjhP followed by MS identification

  • Crosslinking mass spectrometry: Identifying proteins in close proximity to yjhP

In Vitro Interaction Methods:

  • Pull-down assays: Using purified tagged yjhP to identify binding partners

  • Surface plasmon resonance: Quantitative measurement of binding kinetics

  • Isothermal titration calorimetry: Thermodynamic characterization of interactions

Computational Prediction and Integration:

  • Prediction of interaction partners based on genomic context

  • Integration of experimental data with predicted interactions

  • Network analysis to identify functional clusters

For uncharacterized proteins like yjhP, prioritizing interaction studies with proteins encoded by neighboring genes or proteins with similar predicted functions can provide efficient pathways to functional characterization.

How can researchers resolve contradictory functional predictions for yjhP?

When computational approaches yield contradictory predictions for uncharacterized proteins, systematic experimental validation becomes essential:

Assessment of Computational Predictions:

  • Evaluate confidence scores and method reliability

  • Consider evolutionary conservation patterns to prioritize predictions

  • Integrate predictions using consensus approaches

  • Focus on predictions with structural support

Targeted Experimental Validation:

  • Design focused assays to test specific functional hypotheses:

    • Enzymatic activity assays for predicted catalytic functions

    • Binding assays for predicted interaction partners

    • Phenotypic assays for predicted cellular roles

  • Perform site-directed mutagenesis of residues critical to predicted functions

Unbiased Screening Approaches:

  • Phenotypic profiling of knockout strains under diverse conditions

  • Metabolomic analysis to identify affected metabolic pathways

  • Suppressor screens to identify genetic interactions

Integration and Refinement:

  • Update computational models based on experimental results

  • Develop more specific hypotheses for subsequent testing

  • Consider that proteins may have multiple functions in different contexts

This systematic approach recognizes that computational predictions provide valuable starting points but require experimental validation for definitive functional assignment.

What challenges arise in expressing uncharacterized proteins like yjhP?

Expression of uncharacterized proteins presents several common challenges that require systematic troubleshooting:

Challenge: Poor Expression Levels

Solutions:

  • Optimize codon usage for E. coli

  • Test different promoter systems (T7, tac, araBAD)

  • Try various E. coli strains (BL21, Rosetta)

  • Optimize induction parameters, including temperature and inducer concentration

Challenge: Protein Insolubility

Solutions:

  • Express at lower temperatures (18-30°C)

  • Use solubility-enhancing fusion tags (MBP, GST, SUMO)

  • Co-express with molecular chaperones

  • Optimize lysis buffer components

Challenge: Protein Instability

Solutions:

  • Add protease inhibitors during purification

  • Include stabilizing agents (glycerol, arginine, trehalose)

  • Optimize storage conditions

  • Express as fusion with stabilizing partners

Challenge: Toxicity to Host Cells

Solutions:

  • Use tightly regulated expression systems

  • Express in strains resistant to toxic effects (C41/C43)

  • Balance induction strength and cell density

  • Consider cell-free expression systems

For optimal results with uncharacterized proteins, a multifactorial experimental design testing key variables (temperature, time, inducer concentration) is recommended, starting with small-scale expression tests before scaling up.

How should discrepancies between in silico predictions and experimental data be resolved?

Resolving discrepancies between computational predictions and experimental results requires systematic analysis:

Evaluating Computational Predictions:

  • Assess confidence scores and reliability of prediction methods

  • Consider whether predictions account for organism-specific factors

  • Examine if predictions were made using outdated databases

Validating Experimental Results:

  • Ensure experimental reproducibility with adequate replicates

  • Control for expression tag effects that might alter native function

  • Verify that negative results are not due to technical limitations

Reconciliation Strategies:

  • Refine computational models with experimental constraints

  • Consider if the protein has multiple functions or context-dependent activities

  • Investigate if interaction partners required for function were absent in experiments

  • Test function under a broader range of conditions

Decision Framework:

  • When computational predictions fail: Prioritize unbiased experimental approaches

  • When experiments contradict each other: Identify variables that might explain context-dependence

  • When computational and experimental results partially align: Focus on areas of agreement

Addressing discrepancies often leads to more nuanced understanding of protein function and can reveal novel biological insights beyond initial predictions or experimental designs.

What statistical approaches should be used when analyzing yjhP expression data?

Robust statistical analysis is crucial for interpreting expression data for uncharacterized proteins:

Differential Expression Analysis:

  • Student's t-test: For simple two-condition comparisons

  • ANOVA: For multi-condition experiments

  • Multiple testing correction: Benjamini-Hochberg or Bonferroni methods to control false discovery rate

Correlation Analysis:

  • Pearson correlation: For identifying linearly co-expressed genes

  • Spearman correlation: For non-parametric association analysis

  • Network-based approaches: For placing yjhP in functional modules

Experimental Design Considerations:

  • Power analysis: Determining appropriate sample size

  • Randomization: Minimizing batch effects

  • Technical and biological replicates: Distinguishing sources of variation

Data Visualization Methods:

  • Heatmaps: For visualizing condition-dependent expression patterns

  • Principal component analysis: For identifying major sources of variation

  • Volcano plots: For highlighting significantly changed conditions

For uncharacterized proteins like yjhP, expression analysis under diverse conditions can provide the first clues to function, making robust statistical analysis particularly important for generating reliable functional hypotheses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.