Recombinant Escherichia coli Uncharacterized protein yjiH (yjiH)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics of Recombinant Escherichia coli Uncharacterized Protein yjiH

yjiH (UniProt ID: P39379) is a conserved, uncharacterized protein in E. coli K-12 MG1655. Its recombinant form, produced in E. coli, is a full-length (1–227 amino acids) protein fused to an N-terminal histidine (His) tag for purification and solubility enhancement . Key identifiers include:

PropertyValue
Gene NameyjiH
Synonymsb4330, JW5783
Source OrganismE. coli
Recombinant TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

Domain Architecture

yjiH belongs to a conserved bacterial protein family (e.g., YjeQ) with a permuted GTPase domain and RNA-binding motifs . Structural hallmarks include:

  • N-terminal OB-fold: Predicted RNA-binding domain.

  • Circularly permuted GTPase module: Unique G4-G1-G3 motif arrangement (vs. canonical G1-G3-G4 in most GTPases) .

  • C-terminal zinc knuckle-like cluster: May mediate protein-protein interactions.

Expression Systems

Recombinant yjiH is produced using E. coli strains (e.g., BL21(DE3)) with plasmid-based systems . Key challenges in bacterial production include:

  • Protein aggregation: Common in cytoplasmic expression due to redox conditions .

  • Signal peptide dependence: While yjiH lacks a signal peptide, successful secretion requires strain optimization (e.g., E. coli SHuffle® T7) .

Purification and Quality Control

  • Affinity chromatography: His-tag enables nickel/nitrilotriacetic acid (Ni-NTA) resin purification .

  • Purity validation: SDS-PAGE confirms >90% purity, with a molecular weight of ~26 kDa (His-tag + native sequence) .

Role in Translation Regulation

yjiH interacts with ribosomal proteins and translation-related complexes :

  • Phenotypic studies: Deletion mutants exhibit reduced global protein synthesis rates and altered ribosome profiles (e.g., increased 30S/50S subunits vs. 70S monosomes) .

  • Functional overlap: Co-purification with RNA helicases (SrmB, DeaD) and exoribonucleases (Rne, Rnr) suggests involvement in mRNA processing or stability .

Conservation and Essentiality

Homologs like YjeQ are essential in E. coli and *Bacillus subtilis . While yjiH’s essentiality is unconfirmed, its conserved domain architecture implies critical cellular functions.

Biochemical Studies

  • GTPase assays: Recombinant yjiH enables kinetic studies of nucleotide hydrolysis.

  • RNA-binding assays: OB-fold domain interactions with mRNA or rRNA.

Therapeutic and Industrial Relevance

  • Antibiotic targets: Essential GTPases in bacterial translation could inspire novel antimicrobial strategies .

  • Biotechnological tools: His-tagged yjiH may serve as a scaffold for protein engineering or structural studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
yjiH; b4330; JW5783; Uncharacterized protein YjiH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yjiH
Target Protein Sequence
MTQQGDAVAGELATEKVGIKGYLAFFLTIIFFSGVFSGTDSWWRVFDFSVLNGSFGQLPG ANGATTSFRGAGGAGAKDGFLFALELAPSVILSLGIISITDGLGGLRAAQQLMTPVLKPL LGIPGICSLALIANLQNTDAAAGMTKELAQEGEITERDKVIFAAYQTSGSAIITNYFSSG VAVFAFLGTSVIVPLAVILVFKFVGANILRVWLNFEERRNPTQGAQA
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW5783

STRING: 316407.85677073

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key structural features of yjiH protein?

yjiH (UniProt ID: P39379) is a conserved protein in E. coli K-12 MG1655 with 227 amino acids. Its structure includes three notable domains: an N-terminal OB-fold functioning as a predicted RNA-binding domain, a distinctive circularly permuted GTPase module with a unique G4-G1-G3 motif arrangement (differing from the canonical G1-G3-G4 in most GTPases), and a C-terminal zinc knuckle-like cluster that likely mediates protein-protein interactions. This structural organization places it within a conserved bacterial protein family that includes YjeQ, characterized by permuted GTPase domains and RNA-binding motifs. Understanding these structural elements is crucial for hypothesizing about potential functions and designing targeted experimental approaches.

What expression systems yield optimal production of recombinant yjiH?

Recombinant yjiH is most effectively produced using E. coli strains (particularly BL21(DE3)) with plasmid-based expression systems. For optimal expression, the following methodological considerations are critical:

Production ParameterRecommended ApproachChallenge Addressed
Expression TagN-terminal histidine (His) tagEnhances solubility and enables purification
Host Strain SelectionE. coli SHuffle® T7 for secreted formsAddresses signal peptide dependence
Purification MethodNi-NTA affinity chromatographyExploits His-tag for selective binding
Quality ControlSDS-PAGE verificationConfirms >90% purity at ~26 kDa
Buffer CompositionTris/PBS-based with 6% trehalose, pH 8.0Maintains stability in storage

Researchers should monitor potential protein aggregation, which commonly occurs during cytoplasmic expression due to suboptimal redox conditions. For experimental designs requiring secreted forms, strain optimization becomes particularly important despite yjiH lacking a conventional signal peptide.

How can researchers effectively generate homogeneous populations of E. coli expressing yjiH for high-throughput analyses?

Traditional bacterial tolerance studies are challenged by heterogeneous populations. For yjiH studies in the context of stress response or antibiotic tolerance, researchers can employ nutrient-shift protocols to generate nearly homogeneous cell populations. The methodology involves:

  • Culture E. coli cells to mid-exponential phase in glucose-containing medium

  • Perform abrupt nutrient shift from glucose to fumarate

  • Confirm homogeneity via population-level analyses

This approach forces almost all cells into a similar metabolic state, allowing researchers to employ population-averaging experimental methods rather than relying solely on single-cell analyses or cell-sorting approaches . This is particularly valuable when studying proteins like yjiH that may be involved in stress responses or translational regulation. The technique enables application of omics approaches to characterize the proteome, transcriptome, and metabolome under conditions where yjiH function may be relevant .

What methods are most suitable for identifying potential interaction partners of yjiH?

Given yjiH's co-purification with RNA helicases (SrmB, DeaD) and exoribonucleases (Rne, Rnr), methodologically sound approaches to identify interaction partners include:

  • Co-immunoprecipitation coupled with mass spectrometry: Using anti-His antibodies to pull down tagged yjiH and associated proteins, followed by MS identification.

  • Bacterial two-hybrid screening: Creating fusion proteins between yjiH and reporter domains to screen genomic libraries for interacting partners.

  • RNA-protein interaction analysis: Employing CLIP-seq (Crosslinking and Immunoprecipitation followed by sequencing) to identify RNA molecules that interact with yjiH, given its predicted RNA-binding domain.

  • Ribosome profiling: Measuring ribosome occupancy on mRNAs in wild-type versus yjiH deletion strains to determine translational impacts.

These approaches should be complemented with deletion mutant studies, as previous research shows yjiH deletion mutants exhibit reduced global protein synthesis rates and altered ribosome profiles with increased 30S/50S subunits versus 70S monosomes.

How should researchers address contradictory findings when studying yjiH function?

Contradictory findings are common when studying uncharacterized proteins like yjiH. A methodological approach to resolving these contradictions includes:

  • Contextual analysis: Examine experimental conditions (growth phase, media, strain differences) that might explain divergent results.

  • Theoretical framework application: Apply interpretive listening to understand the "logic of practice" behind seemingly contradictory data .

  • Multi-method validation: Rather than relying solely on triangulation to find a single "truth," use complementary methods to understand conditions producing apparent contradictions .

  • Strain-specific variation assessment: Compare yjiH behavior across different E. coli strains, as functional conservation may vary despite sequence homology.

This interpretive analysis approach may not produce a singular "truth" as positivist approaches require, but offers deeper understanding of the biological conditions and contexts in which yjiH functions differently .

What statistical approaches are most appropriate for analyzing high-throughput data related to yjiH functional studies?

When conducting genome-wide association studies or rare variant association studies involving yjiH:

  • Hail Matrix Tables: Organize data using the structure implemented in programs like the All of Us Research Program, where rows represent genetic variants or gene groups and columns contain phenotypic information .

  • Multiple hypothesis correction: Apply Bonferroni or false discovery rate corrections when testing yjiH associations across multiple phenotypes or experimental conditions.

  • Meta-analysis approaches: When combining results from multiple experiments or strains, use fixed or random effects models depending on heterogeneity assessment.

  • Ancestry-aware analysis: In comparative genomics, stratify analyses by bacterial strain lineage to account for evolutionary differences in yjiH conservation and function .

The appropriate statistical framework depends on whether the study examines single-variant effects, gene-based results, or wider phenotypic associations across diverse bacterial strains .

How can researchers leverage Reg-Seq or similar methods to elucidate transcriptional regulation of yjiH?

Regulation of uncharacterized bacterial genes like yjiH remains a significant knowledge gap. Researchers can employ Reg-Seq (Regulatory Sequencing) methodology, which combines massively parallel reporter assays with mass spectrometry to achieve base-pair resolution dissection of promoter regions . This approach involves:

  • Create a library of mutant promoters for yjiH using systematic base-pair substitutions

  • Measure transcriptional output across multiple growth conditions (minimum 12 recommended)

  • Identify transcription factor binding sites through statistical analysis of expression changes

  • Confirm regulatory interactions using mass spectrometry to identify bound transcription factors

This method has successfully identified previously unknown regulatory architectures for genes in the E. coli "y-ome" (genes of unknown function) . For yjiH specifically, this approach could identify condition-specific regulators and integration points with stress response pathways, given its potential role in translation regulation. The full dataset and interactive visualization tools from previous Reg-Seq studies are available as resources (https://www.rpgroup.caltech.edu/RegSeq/interactive)[2].

What are the methodological considerations for assessing antibiotic tolerance phenotypes potentially associated with yjiH?

Given yjiH's association with translation-related complexes and potential involvement in stress responses, researchers investigating its role in antibiotic tolerance should consider these methodological approaches:

  • Flow cytometry-based tolerance assessment: Develop protocols using fluorescent antibiotic markers and viability dyes to quantify tolerance states at the single-cell level .

  • Nutrient-shift tolerance induction: Implement abrupt shifts between carbon sources (glucose to fumarate) to generate homogeneous tolerant populations for subsequent mechanistic studies .

  • Quantification approaches: Beyond traditional plating assays, employ dilution series combined with automated colony counting to determine colony-forming units with statistical rigor .

  • ppGpp level correlation: Measure guanosine tetraphosphate levels in wild-type versus yjiH mutant strains under stress conditions, as tolerant cells typically show elevated ppGpp levels .

  • Proteome characterization: Analyze σS-mediated stress response elements in the context of yjiH presence or absence to identify regulatory connections .

These approaches enable robust assessment of whether yjiH participates in tolerance mechanisms through its potential roles in ribosome maturation, translation regulation, or stress response pathways.

What emerging technologies might advance our understanding of yjiH function?

Several cutting-edge methodologies hold promise for elucidating yjiH function:

  • Cryo-EM structural analysis: Determining high-resolution structures of yjiH alone and in complex with potential binding partners would clarify how its unique GTPase domain arrangement functions biochemically.

  • Single-molecule tracking: Employing fluorescently tagged yjiH to track its subcellular localization and dynamics during different growth phases and stress conditions.

  • Ribosome profiling with rRNA depletion: Adapting ribosome profiling protocols to specifically capture yjiH-associated translation events, potentially revealing condition-specific translational regulation.

  • Metabolic flux analysis: Measuring metabolic changes in wild-type versus yjiH deletion strains to identify potential roles in regulating cellular energetics during stress responses.

  • Whole genome CRISPR screening: Identifying genetic interactions through systematic gene knockout screens in backgrounds with varying yjiH expression levels.

These approaches would complement existing data suggesting yjiH involvement in translation-related processes and potentially uncover novel functions not predicted from sequence analysis alone.

How should researchers integrate yjiH findings with broader bacterial systems biology?

Integration of yjiH research with systems-level understanding requires methodological approaches that span multiple scales:

  • Multi-omics data integration: Combine transcriptomics, proteomics, and metabolomics data from wild-type and yjiH mutant strains to develop comprehensive network models.

  • Evolutionary conservation analysis: Compare yjiH function across bacterial species to identify core conserved functions versus species-specific adaptations.

  • Condition-specific regulatory mapping: Define the regulatory network controlling yjiH expression across diverse environmental conditions using approaches like Reg-Seq .

  • Mathematical modeling: Develop kinetic or constraint-based models incorporating yjiH to predict system-level effects of its modulation.

  • Phenotypic microarray analysis: Screen yjiH mutants across hundreds of growth conditions to identify specific phenotypes that might reveal function.

This integrated approach acknowledges that uncharacterized proteins like yjiH likely serve multiple functions depending on cellular context and environmental conditions, requiring diverse methodological approaches to fully characterize.

How can researchers effectively design control experiments when studying an uncharacterized protein like yjiH?

Designing appropriate controls for yjiH experiments requires careful consideration:

  • Tag-only controls: Express the His-tag portion alone to distinguish tag-mediated effects from genuine yjiH functions.

  • Catalytic mutants: Create point mutations in the GTPase domain to assess nucleotide-dependent functions.

  • Domain deletion variants: Express truncated versions lacking specific domains to determine their individual contributions.

  • Conditional expression systems: Use titratable promoters to assess dose-dependent effects and avoid artifacts from extreme overexpression.

  • Complementation controls: For deletion studies, include both wild-type complementation and domain-specific complementation to confirm phenotype specificity.

These controls help distinguish genuine yjiH functions from experimental artifacts and enable more precise characterization of this uncharacterized protein's roles in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.