Recombinant Escherichia coli Uncharacterized protein ykfM (ykfM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the order method and destination. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless dry ice shipping is specifically requested. Please contact us in advance to arrange dry ice shipping; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its use.
Synonyms
ykfM; b4586; Uncharacterized protein YkfM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ykfM
Target Protein Sequence
MRLHVKLKEFLSMFFMAILFFPAFNASLFFTGVKPLYSIIKCSTEIFYDWRMLILCFGFM SFSFLNIHVILLTIIKSFLIKKTKVVNFATDITIQLTLIFLLIAIVIAPLIAPFVTGYVN TNYHPCGNNTGIFPGAIYIKNGMKCNNGYISRKEDSAVK
Uniprot No.

Target Background

Database Links

KEGG: eco:b4586

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What computational approaches can be used to predict if ykfM is a transcription factor?

    To determine if an uncharacterized protein like ykfM might function as a transcription factor, researchers can employ homology-based algorithms similar to those used for other E. coli proteins. Current estimates suggest E. coli K-12 MG1655 contains approximately 304 candidate transcription factors, with around 50-80 still uncharacterized .

    Methodological approach:

    1. Apply homology-based algorithms to compare ykfM sequence with known transcription factors

    2. Analyze protein domains for DNA-binding motifs using Hidden Markov Models and SUPERFAMILY 2 database

    3. Examine sequence conservation across related species

    4. Use structure prediction tools like AlphaFold to identify potential DNA-binding domains

    For uncharacterized E. coli proteins, this computational approach has demonstrated success, with approximately 62.5% of computationally predicted candidates confirmed as transcription factors through experimental validation .

  • What expression systems work best for recombinant production of uncharacterized E. coli proteins?

    E. coli remains one of the most widely used expression hosts for recombinant proteins due to its rapid growth, well-established genetic background, and availability of commercial vectors and strains .

    Recommended expression systems for uncharacterized proteins:

    Expression SystemAdvantagesLimitationsBest For
    E. coli BL21(DE3)High yield, economical, rapid growthLimited post-translational modificationsCytoplasmic proteins
    E. coli BL21 Star(DE3)Enhanced mRNA stabilitySimilar to BL21(DE3)Proteins sensitive to degradation
    E. coli T7 ShufflePromotes disulfide bond formationReduced growth ratesProteins requiring disulfide bonds
    Insect cellsBetter folding of complex proteinsHigher cost, longer production timeProteins that express poorly in E. coli

    For uncharacterized proteins like ykfM, it's advisable to start with E. coli BL21(DE3) derivatives and move to eukaryotic systems if expression is problematic .

  • How should I design primers for cloning and creating knockout mutants of ykfM?

    Proper primer design is critical for both cloning genes for expression and creating knockout mutants for functional studies. The Keio collection methodology provides an excellent framework for designing primers for gene deletion .

    For knockout creation:

    1. Design primers with 50-bp homology to adjacent chromosomal sequences

    2. Include FLP recognition target (FRT) sites flanking a resistance cassette

    3. Create in-frame deletions that preserve translational signals for downstream genes

    4. Consider gene overlaps that might affect adjacent genes (verify if ykfM overlaps with other genes)

    For expression cloning:

    • Include appropriate restriction sites for your vector system

    • Ensure correct reading frame

    • Consider adding a purification tag (His-tag, GST, etc.)

    • Remove signal peptides if present (analyze sequence with SignalP)

  • What are the significant challenges in expressing uncharacterized proteins like ykfM?

    Expressing uncharacterized proteins presents several challenges that must be addressed through methodical optimization:

    Common expression challenges:

    1. Protein solubility issues - Formation of inclusion bodies containing misfolded protein

    2. Protein toxicity - Inhibition of host cell growth

    3. Codon bias - Differences between host and native codon usage

    4. Improper folding - Lack of proper chaperones or post-translational modifications

    5. Presence of transmembrane domains - Association with membranes and reduced yield

    Experimental data from similar studies shows that solubility issues are particularly common with uncharacterized proteins. A systematic approach using fractional factorial design can help overcome these limitations .

  • How do I determine optimal growth and induction conditions for ykfM expression?

    Optimizing expression conditions is crucial for obtaining sufficient quantities of soluble protein. A statistical experimental design methodology can identify significant variables and their interactions .

    Key variables to optimize:

    ParameterRange to TestNotes
    Induction OD6000.4-1.0Lower densities may increase solubility
    IPTG concentration0.05-1.0 mMLower concentrations often improve solubility
    Expression temperature16-37°CLower temperatures favor proper folding
    Expression time3-16 hoursDepends on temperature
    Media compositionLB, TB, M9Complex vs. defined media
    AdditivesGlucose, glycerolCan affect metabolism and expression

    Research has shown that for many recombinant proteins, induction at OD600 of 0.8 with 0.1 mM IPTG for 4 hours at 25°C in a medium containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose produces optimal results .

Advanced Research Questions

  • What experimental workflow should I follow to systematically characterize ykfM function?

    A comprehensive workflow for characterizing uncharacterized proteins like ykfM should integrate computational predictions with experimental validation .

    Recommended systematic workflow:

    1. Computational analysis

      • Sequence homology analysis

      • Domain/motif identification

      • Structure prediction

    2. Expression and purification

      • Optimize expression using statistical design of experiments

      • Purify using appropriate chromatography methods

    3. Functional characterization

      • If predicted to be a TF: DNA-binding assays (EMSA, ChIP-exo)

      • Protein-protein interaction studies

      • Phenotypic analysis of knockout mutants

    4. Regulon identification (if a TF)

      • Transcriptome analysis (RNA-seq) comparing wild-type and knockout

      • ChIP-exo to identify genome-wide binding sites

      • Motif analysis of binding sites

    This integrated approach has successfully elucidated the functions of previously uncharacterized E. coli proteins such as YiaJ, YdcI, and YeiE .

  • How can ChIP-exo methodology be applied to identify DNA binding sites for ykfM?

    ChIP-exo is a powerful technique for genome-wide identification of transcription factor binding sites with high resolution. For uncharacterized proteins like ykfM, a multiplexed ChIP-exo approach can be particularly efficient .

    ChIP-exo protocol for uncharacterized proteins:

    1. Expression system preparation

      • Create a tagged version of ykfM (e.g., 8x Myc tag)

      • Express in E. coli under native or controlled conditions

    2. ChIP-exo procedure

      • Cross-link protein-DNA complexes

      • Lyse cells and fragment chromatin

      • Immunoprecipitate ykfM-DNA complexes using tag antibody

      • Perform lambda exonuclease digestion to achieve single-nucleotide resolution

      • Prepare sequencing library

    3. Data analysis

      • Identify enriched binding regions compared to control

      • Perform motif analysis using MEME algorithm

      • Compare binding sites with RNA polymerase locations to identify regulatory interactions

    This approach has identified 255 DNA binding peaks for ten previously uncharacterized TFs in E. coli, yielding six high-confidence binding motifs .

  • What statistical approaches should I use for analyzing multifactorial experiments in ykfM characterization?

    For multifactorial experiments (such as optimization of expression conditions), appropriate statistical designs and analyses are crucial to interpret complex interactions between variables .

    Statistical design and analysis approach:

    1. Experimental design options

      • Full factorial design (if resources permit)

      • Fractional factorial design (2^(k-p)) for screening many variables

      • Central composite design for optimization

    2. Analysis methods

      • ANOVA for replicated experiments

      • Normal probability plot of effects for unreplicated experiments

      • Response surface methodology for optimization

    3. Key considerations

      • Include center points to check for curvature

      • Transform data if assumptions are violated (e.g., log-transform for unequal variance)

      • Consider biological replicates vs. technical replicates

    For unreplicated factorial designs, normal probability plots of contrast estimates can identify significant effects when ANOVA cannot be applied .

  • How can I determine if ykfM interacts with RNA polymerase to regulate transcription?

    If ykfM is a transcription factor, understanding its interaction with RNA polymerase is essential for deciphering its regulatory mechanism .

    Methodological approach:

    1. ChIP-exo for both ykfM and RNA polymerase

      • Perform separate ChIP-exo experiments for ykfM and RNAP

      • Compare binding profiles to identify overlapping regions

    2. Quantitative analysis of overlap

      • Calculate the percentage of ykfM binding sites that overlap with RNAP

      • Determine the position of ykfM binding relative to transcription start sites

    3. Functional classification

      • Activator: ykfM binding recruits RNAP

      • Repressor: ykfM binding prevents RNAP association

      • Dual function: context-dependent regulation

    Research on uncharacterized E. coli TFs has shown that approximately 48% (283/588) of TF binding sites overlap with RNA polymerase, indicating direct transcriptional regulation .

  • What phenotypic assays should I perform to validate the function of ykfM?

    Phenotypic analysis of knockout mutants is essential for validating computational predictions and in vitro observations about protein function .

    Comprehensive phenotypic analysis approach:

    1. Generate precise knockout mutant

      • Use Keio collection methodology for in-frame deletion

      • Verify deletion by PCR and sequencing

      • Create complementation strain to confirm phenotype is due to gene deletion

    2. Growth phenotype analysis

      • Test growth in various media (minimal, rich)

      • Examine growth under different stress conditions

      • Perform high-throughput phenotype microarrays (Biolog)

    3. Transcriptome analysis

      • Compare gene expression profiles of wild-type and ΔykfM strains

      • Identify differentially expressed genes

      • Map to metabolic pathways to identify affected processes

    4. Specific functional assays

      • Based on predictions and initial findings

      • May include metabolite analysis, enzyme assays, or stress response tests

    This approach has successfully identified the functions of previously uncharacterized E. coli proteins, including YiaJ as a regulator of L-ascorbate utilization, YdcI as a regulator of proton transfer and acetate metabolism, and YeiE as a regulator of iron homeostasis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.