Recombinant Escherichia coli Uncharacterized protein ykgH (ykgH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ykgH; b0310; JW0302; Uncharacterized protein YkgH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ykgH
Target Protein Sequence
MREQIKQDIDLIEILFYLKKKIRVILFIMAICMAMVLLFLYINKDNIKVIYSLKINQTTP GILVSCDSNNNFACQTTMTEDVIQRITTFFHTSPDVKNREIRLEWSGDKRALPTAEEEIS RVQASIIKWYASEYHNGRQVLDEIQTPSAINSELYTKMIYLTRNWSLYPNGDGCVTISSP EIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSGQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the established methods for recombinant expression of YkgH protein in E. coli?

Recombinant expression of YkgH, like many uncharacterized proteins in E. coli, typically follows standard molecular cloning procedures with specific modifications to optimize solubility. The most effective approach involves:

  • Gene amplification from E. coli genomic DNA using PCR with high-fidelity polymerase

  • Cloning into expression vectors containing appropriate fusion tags (His6, GST, or MBP) to enhance solubility

  • Transformation into expression strains (BL21(DE3), Rosetta, or Arctic Express)

  • Expression optimization through systematic testing of:

    • Induction temperatures (16°C, 25°C, 30°C, 37°C)

    • IPTG concentrations (0.1 mM to 1.0 mM)

    • Expression duration (4 hours to overnight)

Research indicates that uncharacterized proteins like YkgH often form inclusion bodies, requiring careful optimization of expression conditions . A structured, holistic approach using modern bioinformatics and systems-level analysis can significantly improve soluble protein yield .

How can I confirm the identity and purity of recombinant YkgH protein?

Confirmation of identity and purity requires a multi-method approach:

Identity Verification Methods:

  • SDS-PAGE analysis (expected molecular weight comparison)

  • Western blot using anti-His or antibodies against fusion tags

  • Mass spectrometry analysis (MALDI-TOF or LC-MS/MS)

  • N-terminal sequencing for the first 5-10 amino acids

Purity Assessment:

  • Densitometry analysis of SDS-PAGE bands

  • Size exclusion chromatography

  • Analytical ultracentrifugation

For uncharacterized proteins like YkgH, it's crucial to verify that the experimentally expressed protein matches the predicted sequence. Researchers should ensure the recombinant protein is at least 90% of the length of the predicted sequence for reliable functional studies .

What criteria should be used to validate annotations for uncharacterized proteins like YkgH?

Validation of annotations for uncharacterized proteins such as YkgH should follow these specific criteria:

  • Sequence similarity threshold: Ensure >30% amino acid identity with experimentally characterized homologs

  • Length consistency: The experimentally characterized protein should be at least 90% of the length of YkgH, or vice versa

  • Domain conservation: Both proteins should share at least 90% of a commonly conserved domain

  • Experimental validation: Functions assigned must be supported by direct experimental evidence, not merely computational predictions

What expression systems are most suitable for difficult-to-express proteins like YkgH?

For difficult-to-express proteins like YkgH, multiple expression systems should be evaluated:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, simple protocolInclusion body formationCytoplasmic proteins
E. coli C41/C43Specialized for membrane proteinsLower yieldMembrane/toxic proteins
E. coli SHuffleEnhanced disulfide bond formationGrowth slower than BL21Proteins with disulfide bonds
E. coli Arctic ExpressLow-temperature expressionSlow growthProteins prone to misfolding
Cell-free systemsNo cell viability concernsHigher costToxic proteins

Literature analysis indicates no single universally effective approach for difficult-to-express proteins. A systematic strategy using modern bioinformatics and systems-level analysis is recommended . For YkgH specifically, codon optimization and fusion to solubility-enhancing tags like MBP or SUMO can significantly improve expression outcomes.

How can I determine the physiological role of uncharacterized YkgH protein in E. coli?

Determining the physiological role of YkgH requires a comprehensive multi-omics approach:

  • Gene deletion studies:

    • Create precise in-frame deletions of ykgH

    • Perform comparative phenotypic analysis under various growth conditions

    • Analyze cellular morphology, growth rates, stress responses

  • Transcriptomic analysis:

    • Perform RNA-seq comparing wild-type and ΔykgH strains

    • Identify differentially expressed genes in response to deletion

    • Use defined media conditions to systematically examine effects

  • Interaction studies:

    • Conduct pull-down assays with tagged YkgH

    • Perform bacterial two-hybrid screening

    • Use crosslinking mass spectrometry to identify interaction partners

  • Localization studies:

    • Determine subcellular localization using GFP-fusion or immunolocalization

    • Assess membrane association using fractionation techniques

Similar approaches have been successfully applied to other uncharacterized proteins in E. coli, such as YqjA and YghB, revealing their roles in cellular proton motive force homeostasis and inner membrane quality control .

What bioinformatic approaches can predict the function of YkgH protein?

Advanced bioinformatic approaches for functional prediction of YkgH include:

  • Sequence-based methods:

    • Profile hidden Markov models for remote homology detection

    • Position-specific scoring matrices (PSSMs)

    • Conservation analysis across bacterial species

  • Structure-based predictions:

    • AlphaFold2/RoseTTAFold for ab initio structure prediction

    • Structure-based function annotation using tools like COFACTOR and COACH

    • Ligand binding site prediction using CASTp and COACH

  • Genomic context analysis:

    • Gene neighborhood analysis

    • Gene fusion detection

    • Phylogenetic profiling to identify co-evolving genes

  • Deep learning approaches:

    • Models like DeepMGR that incorporate multiple data types to predict gene regulation under different cultivation conditions

    • Neural network models trained on experimentally validated protein functions

Each prediction should be assigned a confidence score, and multiple approaches should be integrated for consensus prediction. The most reliable predictions require experimental validation through targeted assays based on the predicted function.

How can ChIP-exo be used to characterize YkgH if it functions as a transcription factor?

If YkgH functions as a transcription factor, ChromatIn Immunoprecipitation with exonuclease digestion (ChIP-exo) provides a powerful approach to characterize its regulatory role:

  • Experimental setup:

    • Express epitope-tagged YkgH (FLAG, HA, or His) in E. coli

    • Optimize crosslinking conditions (typically 1% formaldehyde for 20 minutes)

    • Perform ChIP-exo following established protocols for bacterial transcription factors

    • Include appropriate controls (input DNA, mock IP)

  • Data analysis:

    • Align sequencing reads to the E. coli genome

    • Identify binding sites using peak-calling algorithms

    • Analyze motifs using MEME or similar tools

    • Compare binding sites with RNA-polymerase occupancy data

  • Functional validation:

    • Construct reporter assays for identified binding sites

    • Perform qRT-PCR to validate transcriptional effects

    • Create point mutations in binding motifs to confirm specificity

This approach has successfully identified binding sites for multiple uncharacterized transcription factors in E. coli, leading to their functional characterization . The integrated analysis of binding sites and transcriptomic data can reveal the complete regulon of YkgH.

What strategies can resolve solubility issues during recombinant expression of YkgH?

Resolving solubility issues for YkgH requires a systematic approach:

StrategyMethodologySuccess RateImplementation Complexity
Fusion tagsMBP, SUMO, TrxA, GST fusionHighLow
Expression conditionsLower temperature (16-25°C), reduced inducer concentrationMediumLow
Codon optimizationOptimize rare codons for E. coli expressionMediumMedium
Chaperone co-expressionGroEL/GroES, DnaK/DnaJ, trigger factorMedium-HighMedium
Truncation constructsExpress stable domains based on bioinformatic predictionVariableMedium
Solubility-enhancing mutationsRational design or directed evolutionVariableHigh
Alternative hostsP. pastoris, insect cells, cell-free systemsHighHigh

Literature analysis of difficult-to-express enzymes in E. coli reveals that researchers often employ disparate practices, lacking a coherent strategy . A systems-level approach integrating protein structure prediction, molecular dynamics simulations, and experimental feedback loops can significantly improve outcomes compared to traditional trial-and-error methods.

How can I design experiments to determine if YkgH is involved in stress response pathways?

To determine YkgH's potential role in stress response pathways:

  • Comparative stress survival assays:

    • Challenge wild-type and ΔykgH strains with:

      • Oxidative stress (H₂O₂, paraquat)

      • Acid stress (pH 4.5-5.5)

      • Osmotic stress (high salt, sorbitol)

      • Temperature stress (42°C, 45°C)

      • Nutrient limitation

    • Quantify survival rates and growth recovery

  • Stress-responsive transcription analysis:

    • Monitor ykgH expression under different stress conditions using:

      • qRT-PCR

      • Transcriptional reporters (ykgH promoter-GFP)

      • RNA-seq to capture global responses

  • Envelope stress response monitoring:

    • Use lacZ fusions to monitor activation of:

      • σᴱ pathway

      • Cpx two-component system

      • Bae pathway

      • Psp response

Similar methodologies have successfully characterized the role of YqjA and YghB proteins in E. coli envelope stress responses, demonstrating that their deletion activates multiple stress response pathways independent of cell division and temperature-sensitive phenotypes .

How can qualitative data analysis be applied to systematically characterize uncharacterized proteins like YkgH?

Systematic characterization of YkgH can benefit from structured qualitative data analysis approaches:

  • Framework development:

    • Define code types for data categorization:

      • Conceptual codes (protein properties, functions)

      • Relationship codes (interactions, regulatory relationships)

      • Perspective codes (different experimental approaches)

      • Participant characteristics (strain-specific effects)

      • Setting codes (experimental conditions)

  • Data collection and coding:

    • Gather experimental data from multiple approaches

    • Apply predetermined code types to organize findings

    • Use inductive reasoning to identify emerging patterns

  • Analysis and interpretation:

    • Develop taxonomies from conceptual codes

    • Generate themes from relationship and perspective codes

    • Perform intersectional analyses using participant and setting codes

    • Build theoretical models explaining YkgH function

This approach applies principles from qualitative health services research to protein characterization, providing a structured way to integrate diverse experimental data into coherent functional models. It is particularly valuable for uncharacterized proteins where initial hypotheses may be limited.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.