Recombinant Escherichia coli Uncharacterized protein YlaB (ylaB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli Uncharacterized Protein YlaB (YlaB)

Recombinant Escherichia coli Uncharacterized protein YlaB (YlaB) refers to a protein of unknown function that is produced using recombinant DNA technology in Escherichia coli . The ylaB gene is present in E. coli K-12 MG1655 .

  • YlaB proteins can be expressed in E. coli with a fused N-terminal His tag .

Characteristics and Function Prediction

YlaB is an uncharacterized protein, and research aims to identify its functions, such as its potential role as a transcription factor (TF) . Studies have used methods like multiplexed chromatin immunoprecipitation combined with lambda exonuclease digestion (multiplexed ChIP-exo) assays to identify DNA-binding sites for candidate TFs, including YlaB .

  • DNA-Binding: Some studies focus on identifying YlaB as a DNA-binding protein .

  • Regulation of Transcription: Research explores how YlaB and other candidate TFs regulate transcription initiation .

Role in Acid Resistance and Biofilm Formation

Some research indicates a connection between related proteins and acid resistance and biofilm formation in E. coli . For instance, the ymgABC gene cluster, which is related to YlaB, plays a role in biofilm development and stability .

  • YmgB, a protein associated with the ymgABC cluster, represses biofilm formation in rich medium containing glucose, decreases cellular motility, and protects the cell from acid .

  • YmgB may mediate acid resistance .

  • YmgB may be a non-specific DNA-binding protein .

Recombinant Protein Expression in E. coli

Recombinant protein expression in E. coli is a widely used technique for producing proteins like YlaB .

  • Tunable Promoters: Approaches for synthesizing recombinant proteins in E. coli involve tunable promoters like araPBAD, which are inducible by sugars such as arabinose .

  • Expression Control: The concentration of inducer (e.g., L-rhamnose for rhaPBAD) can control the amount of recombinant protein expressed .

  • Secretion Strategies: Secretion to the periplasm or the medium can be employed to produce recombinant proteins, using signal peptides such as Lpp, LamB, OmpA, or PhoA .

Metabolomics and Yersiniabactin Derivatives

While not directly linked to YlaB, metabolomics studies on E. coli strains provide a broader context for understanding bacterial metabolism and the production of various metabolites .

  • Yersiniabactin (Ybt) and its derivatives, such as escherichelin and ulbactin B, have been detected in the metabolome of E. coli strains .

  • These metabolites can differentiate the metabolomes of different E. coli strains .

ELISA and Availability

ELISA kits for recombinant Escherichia coli Uncharacterized protein YlaB(YlaB) are available for purchase .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
pdeB; ylaB; b0457; JW5062; Probable cyclic di-GMP phosphodiesterase PdeB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pdeB
Target Protein Sequence
MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYSSRVAIRANKVATQGK DALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVAYIDNNVPQCSSLEHESPPDTFPEP GKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFIDVIPYSSWQIDAAIIGNA HNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPLPEMNISIITWASTKMLQKGWH RQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIENRDICVHYQPIVSLANGKIV GAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIRSVFEDMGDWLRQHPQQHISI NLESPVLTSEKIPQLLRDMINHYQVNPRQIALELTEREFADPKTSAPIISRYREAGHEIY LDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVTPHIIEMAKTLKLKMVAEGIETS KQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL
Uniprot No.

Target Background

Function
This protein is a phosphodiesterase (PDE) that catalyzes the hydrolysis of cyclic-di-GMP (c-di-GMP) to 5'-pGpG.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does E. coli YlaB differ from Bacillus subtilis YlaB?

Despite sharing the same name, the YlaB proteins from E. coli and B. subtilis exhibit significant differences in size, sequence, and likely function. The E. coli YlaB (P77473) is 516 amino acids long and functions as a probable cyclic di-GMP phosphodiesterase, while the B. subtilis YlaB (O07626) is much smaller at 89 amino acids with currently unknown function .

Comparison of key characteristics:

CharacteristicE. coli YlaBB. subtilis YlaB
UniProt IDP77473O07626
Length516 amino acids89 amino acids
Known synonymspdeB, b0457, JW5062BSU14720
FunctionProbable cyclic di-GMP phosphodiesteraseUncharacterized
Amino acid sequenceMRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS... (full 516aa)MNHKEKESVFVDLYDLYKEGELEDESMEWMKQHESLFQKNAEDLKSKTCLKRSPGAEEES QIRYMKVYLSSMYICFILLAIWMTVWFYF

When designing comparative studies, researchers should be aware that these proteins may have evolved to serve different functions despite the shared nomenclature. Homology searches and phylogenetic analyses would be recommended methodological approaches to understand their evolutionary relationship .

What are the optimal storage conditions for recombinant YlaB protein?

Recombinant YlaB protein requires careful storage to maintain stability and biological activity. Store the lyophilized powder at -20°C to -80°C upon receipt, with proper aliquoting for multiple uses. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity .

The recommended storage protocol includes:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for long-term storage

  • Aliquoting to minimize freeze-thaw cycles

  • Storage at -20°C/-80°C for long-term preservation

The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage. When designing experiments that require this protein, incorporate appropriate controls to verify protein activity after storage and reconstitution .

What experimental designs are most appropriate for studying YlaB protein function?

When investigating YlaB protein function, selecting an appropriate experimental design is crucial for obtaining valid and reliable results. The choice of design should be guided by the research question, available resources, and the need to control variability.

For experiments involving multiple variables (such as temperature, pH, substrate concentration), a Randomized Block Design (RBD) is often more appropriate. In this design:

  • Experimental units are grouped into homogeneous blocks to reduce variability

  • Each treatment (e.g., different conditions for YlaB testing) appears once in each block

  • Treatments are randomly assigned within each block

  • Analysis partitions variance due to blocks from the experimental error

For even more complex scenarios where three factors need to be controlled (e.g., different E. coli strains, environmental conditions, and substrate types), a Latin Square Design (LSD) may be optimal, allowing for:

  • Control of two blocking factors simultaneously

  • Reduced experimental units (v² instead of v³ for complete replication)

  • Reduced error variance by removing row and column effects

The choice between these designs depends on the specific research questions about YlaB and practical constraints. For example, when studying phosphodiesterase activity of YlaB under various conditions, an RBD might allow for blocking by batch of protein preparation, reducing the impact of preparation-to-preparation variability on experimental outcomes .

How should researchers design validation experiments for YlaB phosphodiesterase activity?

Validating the putative cyclic di-GMP phosphodiesterase activity of YlaB (PdeB) requires a systematic experimental approach. A comprehensive validation protocol should include:

  • Enzymatic assays: Design experiments to directly measure phosphodiesterase activity using:

    • Colorimetric assays with specific substrates

    • HPLC-based methods to detect cyclic di-GMP degradation products

    • Real-time monitoring of activity using fluorescent reporters

  • Site-directed mutagenesis: Create strategic mutations in predicted catalytic domains and measure:

    • Effects on enzymatic activity

    • Structural changes using circular dichroism

    • Substrate binding capability

  • Complementation studies: Design genetic experiments where:

    • YlaB-deficient strains are complemented with wild-type or mutant alleles

    • Phenotypic rescue is measured quantitatively

    • Cyclic di-GMP levels are monitored in vivo

  • Controls: Always include:

    • Positive controls (known phosphodiesterases)

    • Negative controls (enzymatically inactive mutants)

    • Vehicle controls for all reagents

A robust experimental design would incorporate replication (minimum triplicate samples) and randomization to control for batch effects and other sources of variation. Statistical planning should include power analysis to determine appropriate sample sizes for detecting biologically meaningful differences in activity .

What approaches can be used to determine YlaB protein localization in E. coli?

Determining the subcellular localization of YlaB protein in E. coli requires multiple complementary techniques to ensure reliable results. A comprehensive experimental strategy should include:

  • Fluorescent protein fusion approaches:

    • Design N- and C-terminal GFP/mCherry fusions of YlaB

    • Express from native promoter when possible to maintain physiological levels

    • Use time-lapse microscopy to track localization during different growth phases

    • Apply appropriate controls to verify fusion protein functionality

  • Immunolocalization methods:

    • Generate specific antibodies against purified YlaB protein

    • Validate antibody specificity using Western blot analysis

    • Perform immunofluorescence microscopy with appropriate fixation protocols

    • Include YlaB knockout strains as negative controls

  • Subcellular fractionation:

    • Design fractionation protocols to separate cytoplasmic, membrane, and periplasmic components

    • Analyze fractions by Western blotting with anti-YlaB antibodies

    • Include marker proteins for each cellular compartment as controls

    • Quantify relative distribution across fractions

  • Experimental design considerations:

    • Use randomized block design to account for batch effects

    • Include multiple biological replicates (minimum 3)

    • Test localization under different growth conditions relevant to YlaB function

    • Apply statistical analysis to quantify localization patterns

When interpreting results, researchers should compare findings across multiple techniques, as each method has inherent limitations. Discrepancies between methods can provide valuable insights into protein dynamics or technical artifacts that require further investigation .

How can researchers design experiments to elucidate YlaB's role in cyclic di-GMP signaling networks?

Elucidating YlaB's role in cyclic di-GMP signaling networks requires sophisticated experimental approaches that integrate genetic, biochemical, and systems biology techniques. A comprehensive research strategy should include:

  • Genetic interaction mapping:

    • Construct single and double mutants of YlaB with other cyclic di-GMP metabolism genes

    • Apply Latin Square Design for efficient screening of genetic interactions

    • Measure phenotypes related to biofilm formation, motility, and virulence

    • Analyze epistatic relationships to position YlaB in signaling hierarchies

  • Quantitative cyclic di-GMP measurements:

    • Design experiments using LC-MS/MS to measure absolute cyclic di-GMP levels

    • Implement randomized block design to control for batch effects

    • Compare wild-type, YlaB knockout, and YlaB overexpression strains

    • Measure dynamics under various environmental conditions

  • Protein interaction studies:

    • Apply pull-down assays with tagged YlaB to identify interaction partners

    • Validate interactions using bacterial two-hybrid systems

    • Map interaction domains through truncation analysis

    • Quantify interaction affinities using surface plasmon resonance or microscale thermophoresis

  • Transcriptomics and proteomics:

    • Design RNA-Seq experiments comparing wild-type and YlaB mutant strains

    • Apply differential expression analysis to identify YlaB-dependent gene regulation

    • Conduct quantitative proteomics to detect post-transcriptional effects

    • Integrate multi-omics data to infer regulatory networks

Statistical considerations should include appropriate sample sizes for detecting biologically relevant differences, methods for controlling false discovery rates in high-throughput data, and validation of key findings using independent experimental approaches .

What are the methodological challenges in structural characterization of YlaB protein?

Structural characterization of YlaB protein presents significant methodological challenges due to its size (516 amino acids), potential membrane association, and limited prior knowledge. Researchers should consider the following approaches and their associated challenges:

  • X-ray crystallography challenges:

    • Optimization of protein expression and purification conditions to obtain protein quantities sufficient for crystallization (10-50 mg)

    • Identification of suitable detergents for membrane-associated domains

    • Screening hundreds of crystallization conditions (systematic approach using factorial designs)

    • Managing protein flexibility that may impede crystal formation

  • NMR spectroscopy limitations:

    • Size constraints, as the 516-amino acid YlaB exceeds typical limits for traditional NMR approaches

    • Need for isotopic labeling (15N, 13C, 2H) requiring specialized expression systems

    • Development of domain-focused approaches for regions of particular interest

    • Data processing and structural calculation complexity

  • Cryo-electron microscopy considerations:

    • Sample preparation optimization to ensure homogeneity

    • Protein concentration and vitrification conditions

    • Particle picking and classification challenges

    • Resolution limitations for smaller proteins like YlaB

  • Integrative structural biology approaches:

    • Combination of low-resolution techniques (SAXS, SANS) with computational modeling

    • Application of crosslinking mass spectrometry to obtain distance constraints

    • Hydrogen-deuterium exchange mass spectrometry for dynamics information

    • Use of AlphaFold2 or similar prediction tools as starting models for refinement

Statistical validation of structural data is essential, including R-factors for crystallography, NOE violations for NMR, and resolution statistics for cryo-EM. Researchers should implement randomized experimental designs when conducting structural studies to minimize systematic errors and maximize reproducibility .

How can researchers design experiments to investigate the relationship between YlaB and bacterial biofilm formation?

Investigating the relationship between YlaB (PdeB) and bacterial biofilm formation requires systematic experimentation across multiple scales, from molecular to community levels. An effective experimental strategy should include:

  • Genetic manipulation approaches:

    • Construction of clean deletion mutants using lambda Red recombination or CRISPR-Cas9

    • Complementation with wild-type and point-mutated YlaB variants

    • Development of inducible expression systems for dose-dependent studies

    • Creation of reporter fusions to monitor YlaB expression during biofilm development

  • Quantitative biofilm assays:

    • Static microtiter plate assays with crystal violet staining

    • Flow cell systems for dynamic biofilm formation

    • Confocal laser scanning microscopy with fluorescent reporters

    • Biomass and biofilm architecture quantification using COMSTAT or similar software

  • Molecular mechanism studies:

    • Measurement of cyclic di-GMP levels in biofilm vs. planktonic cells

    • Identification of YlaB-dependent exopolysaccharide production

    • Analysis of transcriptional profiles during biofilm development

    • Investigation of protein-protein interactions in biofilm context

  • Experimental design considerations:

    • Implementation of randomized block design to control for environmental variables

    • Inclusion of appropriate reference strains (positive and negative controls)

    • Multiple biological replicates (minimum 3) and technical replicates

    • Time-course experiments to capture developmental stages

Statistical analysis should include ANOVA for comparing biofilm formation across multiple strains and conditions, with post-hoc tests for specific comparisons. Multivariate analyses may be appropriate for integrating multiple biofilm parameters. Power analysis should be conducted to ensure sufficient sample sizes for detecting biologically meaningful differences in biofilm formation .

What are the optimal conditions for expression and purification of recombinant YlaB protein?

Optimizing expression and purification of recombinant YlaB protein requires careful consideration of multiple factors to ensure high yield, purity, and biological activity. Based on current protocols, the following methodology is recommended:

  • Expression system optimization:

    • Host strain: E. coli BL21(DE3) or derivatives show good results for YlaB expression

    • Vector selection: pET-based vectors with T7 promoter and N-terminal His-tag

    • Induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours)

    • Media formulation: Test rich media (LB, TB) versus defined media for optimal expression

    • Consider a factorial design experiment to identify optimal combinations of these factors

  • Purification strategy:

    • Primary capture: Immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

    • Intermediate purification: Ion exchange chromatography

    • Polishing step: Size exclusion chromatography

    • Buffer optimization: Test various buffer compositions, pH values, and salt concentrations

    • Protein stability enhancers: Consider adding glycerol, reducing agents, or specific metal ions

  • Quality control measures:

    • SDS-PAGE analysis: Verify >90% purity

    • Western blotting: Confirm identity with anti-His antibodies

    • Activity assays: Verify functional phosphodiesterase activity

    • Mass spectrometry: Confirm protein identity and detect potential modifications

    • Dynamic light scattering: Assess homogeneity and aggregation state

  • Storage and stability:

    • Lyophilization with 6% trehalose in Tris/PBS-based buffer, pH 8.0

    • Reconstitution in deionized water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage

    • Storage at -20°C/-80°C with avoidance of freeze-thaw cycles

The experimental design should include control proteins expressed and purified under identical conditions and statistical analysis of yield and purity across multiple purification batches to ensure reproducibility .

What approaches can be used to study YlaB protein-protein interactions in bacterial systems?

Investigating YlaB protein-protein interactions requires a multi-faceted approach to identify, validate, and characterize interaction partners. The following methodological strategies are recommended:

  • In vivo interaction identification methods:

    • Bacterial two-hybrid (B2H) system: Fuse YlaB to one domain of a split transcription factor and potential partners to the complementary domain

    • Protein-fragment complementation assays: Split-GFP or split-luciferase fusions

    • Crosslinking coupled with mass spectrometry (XL-MS): In vivo crosslinking followed by affinity purification and MS identification

    • Design controls including non-interacting protein pairs and known interacting pairs

  • Affinity-based approaches:

    • Co-immunoprecipitation with anti-YlaB antibodies or epitope tags

    • Tandem affinity purification (TAP) with dual-tagged YlaB

    • Pull-down assays with His-tagged YlaB as bait

    • Implement randomized block design to account for batch effects

    • Include appropriate negative controls and competition assays to verify specificity

  • Biophysical interaction characterization:

    • Surface plasmon resonance (SPR) for kinetic and affinity measurements

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interaction in solution

    • Bio-layer interferometry (BLI) for real-time interaction analysis

    • Design concentration gradients and replicate measurements for robust curve fitting

  • Structural studies of complexes:

    • Co-crystallization of YlaB with interaction partners

    • Cryo-EM analysis of larger complexes

    • NMR chemical shift perturbation to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

Statistical analysis should include assessment of interaction significance versus background, determination of dissociation constants with confidence intervals, and comparison of interaction profiles across different experimental conditions .

How can researchers effectively analyze YlaB phosphodiesterase activity data?

  • Experimental design considerations for robust analysis:

    • Implement nested designs with technical replicates within biological replicates

    • Include standard curves with known phosphodiesterase enzymes

    • Establish appropriate negative controls (heat-inactivated enzyme, catalytic mutants)

    • Apply randomized block design to control for batch effects in reagents and instrumentation

  • Data preprocessing and quality control:

    • Evaluate raw data for outliers using statistical tests (Grubbs' test, Dixon's Q test)

    • Assess normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Transform data if necessary (log transformation for enzymatic data often appropriate)

    • Calculate coefficients of variation for technical replicates (<15% typically acceptable)

  • Statistical analysis methods:

    • For comparison across conditions: ANOVA with appropriate post-hoc tests

    • For enzyme kinetics: Non-linear regression for Michaelis-Menten parameters

    • For inhibition studies: IC50 determination with confidence intervals

    • For time-course experiments: Repeated measures ANOVA or mixed-effects models

    Analysis TypeAppropriate Statistical MethodKey Parameters
    Enzyme KineticsNon-linear regressionK<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub>
    Condition ComparisonOne-way or factorial ANOVAF-statistic, p-value, effect size
    Inhibition AnalysisFour-parameter logistic regressionIC<sub>50</sub>, Hill slope
    Temperature/pH EffectsSecond-order polynomial fitsOptimal conditions, stability range
  • Advanced analytical approaches:

    • Principal component analysis for multi-parameter optimization

    • Response surface methodology for identifying optimal reaction conditions

    • Bayesian analysis for incorporating prior knowledge about similar enzymes

    • Meta-analysis when combining results across multiple experiments

  • Visualization recommendations:

    • Enzyme kinetic curves with data points and fitted curves

    • Bar graphs with individual data points overlaid

    • Heat maps for multi-parameter optimization studies

    • Forest plots for comparing effects across multiple conditions

All statistical analyses should report both statistical significance and effect sizes, with appropriate error bars (preferably 95% confidence intervals rather than standard error). P-values should be adjusted for multiple comparisons using methods such as Bonferroni or Benjamini-Hochberg procedures .

What are the most promising research directions for understanding YlaB function?

Based on current knowledge about YlaB (PdeB) in E. coli, several promising research directions emerge for advancing our understanding of this protein's function and significance. Researchers should consider prioritizing:

  • Structural biology approaches:

    • Determination of high-resolution structures of YlaB alone and in complex with substrates

    • Identification of critical catalytic residues and regulatory domains

    • Comparison with other phosphodiesterases to understand evolutionary relationships

    • Structure-guided design of specific inhibitors as research tools

  • Systems biology integration:

    • Mapping YlaB's position within the broader cyclic di-GMP signaling network

    • Identification of environmental signals that modulate YlaB activity

    • Integration of YlaB function with global bacterial stress responses

    • Multi-omics approaches to understand downstream effects of YlaB activity

  • Physiological relevance studies:

    • Investigation of YlaB's role in biofilm formation and dispersal

    • Analysis of contributions to bacterial persistence and antibiotic tolerance

    • Examination of potential roles in pathogenesis and host-microbe interactions

    • Assessment of YlaB as a potential antimicrobial target

  • Methodological innovations:

    • Development of real-time sensors for monitoring YlaB activity in vivo

    • Application of cryo-electron tomography for visualizing YlaB in its native context

    • Implementation of CRISPR interference for precise temporal control of YlaB expression

    • Adaptation of microfluidic systems for single-cell analysis of YlaB function

Future experimental designs should emphasize integration across these areas, combining structural insights with functional studies and systems-level approaches. Latin Square and Randomized Block Designs will be particularly valuable for efficiently exploring multiple variables while controlling for experimental noise .

How can researchers integrate computational approaches with experimental studies of YlaB?

Integrating computational approaches with experimental studies of YlaB creates powerful synergies for accelerating research progress and generating novel hypotheses. A comprehensive integration strategy should include:

  • Structural prediction and analysis:

    • Apply AlphaFold2 or RoseTTAFold for generating high-confidence structural models

    • Use molecular dynamics simulations to study conformational dynamics

    • Perform virtual screening for potential substrates or inhibitors

    • Guide experimental design by identifying critical residues for mutagenesis

    • Validate computational predictions with experimental structural data

  • Network analysis and systems biology:

    • Construct gene regulatory networks incorporating YlaB

    • Identify potential transcription factors controlling YlaB expression

    • Predict metabolic impacts of YlaB activity using flux balance analysis

    • Model cyclic di-GMP signaling dynamics with ordinary differential equations

    • Design factorial experiments to test computational predictions

  • Advanced data analysis methods:

    • Apply machine learning for pattern recognition in YlaB activity datasets

    • Use Bayesian statistics for incorporating prior knowledge into new findings

    • Implement principal component analysis for dimensionality reduction

    • Develop custom algorithms for analyzing high-throughput YlaB functional screens

    • Design statistically rigorous validation experiments for computational hypotheses

  • Integrated research workflow:

    Computational ApproachExperimental ValidationIntegration Strategy
    Structural predictionSite-directed mutagenesisTarget predicted functional residues
    Molecular dockingBinding assaysTest top-ranked predicted ligands
    Network inferenceGene knockoutsValidate predicted regulatory connections
    Dynamics simulationFRET sensorsMonitor predicted conformational changes
    Evolution analysisComplementation with homologsTest functional conservation

By implementing this integrated approach, researchers can establish virtuous cycles where computational predictions guide experimental design, and experimental results refine computational models. This iterative process accelerates discovery while maximizing resource efficiency. Experimental designs should incorporate appropriate controls to validate computational predictions and statistical analyses to quantify agreement between predicted and observed outcomes .

What methodological advances would accelerate YlaB research?

Accelerating YlaB research requires methodological innovations across multiple technical domains. The following advances would significantly enhance research capabilities:

  • High-throughput functional assays:

    • Development of fluorescent or luminescent reporters for real-time monitoring of YlaB activity

    • Adaptation of phosphodiesterase assays to microplate formats for increased throughput

    • Creation of cell-based screens for YlaB function in various genetic backgrounds

    • Implementation of Latin Square Design for efficient screening of multiple variables simultaneously

  • Advanced imaging technologies:

    • Single-molecule localization microscopy to track YlaB dynamics in living cells

    • Correlative light and electron microscopy to connect YlaB localization with ultrastructural features

    • Super-resolution microscopy to visualize YlaB within bacterial signaling complexes

    • Fluorescence lifetime imaging to detect YlaB protein-protein interactions in vivo

  • Genetic and protein engineering tools:

    • CRISPR interference systems for precise temporal control of YlaB expression

    • Split-protein complementation systems optimized for YlaB interaction studies

    • Synthetic biology approaches to rewire YlaB regulatory networks

    • Genetically encoded biosensors for cyclic di-GMP to monitor YlaB activity in real-time

  • Structural biology innovations:

    • Application of cryo-electron tomography for visualizing YlaB in its native cellular context

    • Development of nanobodies or synthetic binding proteins as crystallization chaperones

    • Microcrystal electron diffraction for structure determination from sub-micron crystals

    • Hydrogen-deuterium exchange mass spectrometry workflows optimized for membrane-associated proteins

  • Data integration frameworks:

    • Development of specialized databases for cyclic di-GMP signaling components

    • Machine learning approaches for predicting YlaB interaction partners

    • Computational pipelines integrating transcriptomic, proteomic, and metabolomic data

    • Standardized data reporting formats to facilitate meta-analyses across studies

These methodological advances should be implemented within robust experimental designs that incorporate appropriate controls, randomization, and statistical power analysis. Randomized Block Designs would be particularly valuable for evaluating new methods against established techniques while controlling for experimental variables .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.