Recombinant Escherichia coli Uncharacterized protein YlaB (YlaB) refers to a protein of unknown function that is produced using recombinant DNA technology in Escherichia coli . The ylaB gene is present in E. coli K-12 MG1655 .
YlaB is an uncharacterized protein, and research aims to identify its functions, such as its potential role as a transcription factor (TF) . Studies have used methods like multiplexed chromatin immunoprecipitation combined with lambda exonuclease digestion (multiplexed ChIP-exo) assays to identify DNA-binding sites for candidate TFs, including YlaB .
DNA-Binding: Some studies focus on identifying YlaB as a DNA-binding protein .
Regulation of Transcription: Research explores how YlaB and other candidate TFs regulate transcription initiation .
Some research indicates a connection between related proteins and acid resistance and biofilm formation in E. coli . For instance, the ymgABC gene cluster, which is related to YlaB, plays a role in biofilm development and stability .
YmgB, a protein associated with the ymgABC cluster, represses biofilm formation in rich medium containing glucose, decreases cellular motility, and protects the cell from acid .
Recombinant protein expression in E. coli is a widely used technique for producing proteins like YlaB .
Tunable Promoters: Approaches for synthesizing recombinant proteins in E. coli involve tunable promoters like araPBAD, which are inducible by sugars such as arabinose .
Expression Control: The concentration of inducer (e.g., L-rhamnose for rhaPBAD) can control the amount of recombinant protein expressed .
Secretion Strategies: Secretion to the periplasm or the medium can be employed to produce recombinant proteins, using signal peptides such as Lpp, LamB, OmpA, or PhoA .
While not directly linked to YlaB, metabolomics studies on E. coli strains provide a broader context for understanding bacterial metabolism and the production of various metabolites .
Yersiniabactin (Ybt) and its derivatives, such as escherichelin and ulbactin B, have been detected in the metabolome of E. coli strains .
These metabolites can differentiate the metabolomes of different E. coli strains .
ELISA kits for recombinant Escherichia coli Uncharacterized protein YlaB(YlaB) are available for purchase .
KEGG: ecj:JW5062
STRING: 316385.ECDH10B_0413
Despite sharing the same name, the YlaB proteins from E. coli and B. subtilis exhibit significant differences in size, sequence, and likely function. The E. coli YlaB (P77473) is 516 amino acids long and functions as a probable cyclic di-GMP phosphodiesterase, while the B. subtilis YlaB (O07626) is much smaller at 89 amino acids with currently unknown function .
Comparison of key characteristics:
| Characteristic | E. coli YlaB | B. subtilis YlaB |
|---|---|---|
| UniProt ID | P77473 | O07626 |
| Length | 516 amino acids | 89 amino acids |
| Known synonyms | pdeB, b0457, JW5062 | BSU14720 |
| Function | Probable cyclic di-GMP phosphodiesterase | Uncharacterized |
| Amino acid sequence | MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS... (full 516aa) | MNHKEKESVFVDLYDLYKEGELEDESMEWMKQHESLFQKNAEDLKSKTCLKRSPGAEEES QIRYMKVYLSSMYICFILLAIWMTVWFYF |
When designing comparative studies, researchers should be aware that these proteins may have evolved to serve different functions despite the shared nomenclature. Homology searches and phylogenetic analyses would be recommended methodological approaches to understand their evolutionary relationship .
Recombinant YlaB protein requires careful storage to maintain stability and biological activity. Store the lyophilized powder at -20°C to -80°C upon receipt, with proper aliquoting for multiple uses. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity .
The recommended storage protocol includes:
Brief centrifugation of the vial prior to opening to bring contents to the bottom
Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Addition of 5-50% glycerol (final concentration) for long-term storage
Aliquoting to minimize freeze-thaw cycles
The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage. When designing experiments that require this protein, incorporate appropriate controls to verify protein activity after storage and reconstitution .
When investigating YlaB protein function, selecting an appropriate experimental design is crucial for obtaining valid and reliable results. The choice of design should be guided by the research question, available resources, and the need to control variability.
For experiments involving multiple variables (such as temperature, pH, substrate concentration), a Randomized Block Design (RBD) is often more appropriate. In this design:
Experimental units are grouped into homogeneous blocks to reduce variability
Each treatment (e.g., different conditions for YlaB testing) appears once in each block
Treatments are randomly assigned within each block
Analysis partitions variance due to blocks from the experimental error
For even more complex scenarios where three factors need to be controlled (e.g., different E. coli strains, environmental conditions, and substrate types), a Latin Square Design (LSD) may be optimal, allowing for:
Control of two blocking factors simultaneously
Reduced experimental units (v² instead of v³ for complete replication)
The choice between these designs depends on the specific research questions about YlaB and practical constraints. For example, when studying phosphodiesterase activity of YlaB under various conditions, an RBD might allow for blocking by batch of protein preparation, reducing the impact of preparation-to-preparation variability on experimental outcomes .
Validating the putative cyclic di-GMP phosphodiesterase activity of YlaB (PdeB) requires a systematic experimental approach. A comprehensive validation protocol should include:
Enzymatic assays: Design experiments to directly measure phosphodiesterase activity using:
Colorimetric assays with specific substrates
HPLC-based methods to detect cyclic di-GMP degradation products
Real-time monitoring of activity using fluorescent reporters
Site-directed mutagenesis: Create strategic mutations in predicted catalytic domains and measure:
Effects on enzymatic activity
Structural changes using circular dichroism
Substrate binding capability
Complementation studies: Design genetic experiments where:
YlaB-deficient strains are complemented with wild-type or mutant alleles
Phenotypic rescue is measured quantitatively
Cyclic di-GMP levels are monitored in vivo
Controls: Always include:
Positive controls (known phosphodiesterases)
Negative controls (enzymatically inactive mutants)
Vehicle controls for all reagents
A robust experimental design would incorporate replication (minimum triplicate samples) and randomization to control for batch effects and other sources of variation. Statistical planning should include power analysis to determine appropriate sample sizes for detecting biologically meaningful differences in activity .
Determining the subcellular localization of YlaB protein in E. coli requires multiple complementary techniques to ensure reliable results. A comprehensive experimental strategy should include:
Fluorescent protein fusion approaches:
Design N- and C-terminal GFP/mCherry fusions of YlaB
Express from native promoter when possible to maintain physiological levels
Use time-lapse microscopy to track localization during different growth phases
Apply appropriate controls to verify fusion protein functionality
Immunolocalization methods:
Generate specific antibodies against purified YlaB protein
Validate antibody specificity using Western blot analysis
Perform immunofluorescence microscopy with appropriate fixation protocols
Include YlaB knockout strains as negative controls
Subcellular fractionation:
Design fractionation protocols to separate cytoplasmic, membrane, and periplasmic components
Analyze fractions by Western blotting with anti-YlaB antibodies
Include marker proteins for each cellular compartment as controls
Quantify relative distribution across fractions
Experimental design considerations:
When interpreting results, researchers should compare findings across multiple techniques, as each method has inherent limitations. Discrepancies between methods can provide valuable insights into protein dynamics or technical artifacts that require further investigation .
Elucidating YlaB's role in cyclic di-GMP signaling networks requires sophisticated experimental approaches that integrate genetic, biochemical, and systems biology techniques. A comprehensive research strategy should include:
Genetic interaction mapping:
Construct single and double mutants of YlaB with other cyclic di-GMP metabolism genes
Apply Latin Square Design for efficient screening of genetic interactions
Measure phenotypes related to biofilm formation, motility, and virulence
Analyze epistatic relationships to position YlaB in signaling hierarchies
Quantitative cyclic di-GMP measurements:
Design experiments using LC-MS/MS to measure absolute cyclic di-GMP levels
Implement randomized block design to control for batch effects
Compare wild-type, YlaB knockout, and YlaB overexpression strains
Measure dynamics under various environmental conditions
Protein interaction studies:
Apply pull-down assays with tagged YlaB to identify interaction partners
Validate interactions using bacterial two-hybrid systems
Map interaction domains through truncation analysis
Quantify interaction affinities using surface plasmon resonance or microscale thermophoresis
Transcriptomics and proteomics:
Statistical considerations should include appropriate sample sizes for detecting biologically relevant differences, methods for controlling false discovery rates in high-throughput data, and validation of key findings using independent experimental approaches .
Structural characterization of YlaB protein presents significant methodological challenges due to its size (516 amino acids), potential membrane association, and limited prior knowledge. Researchers should consider the following approaches and their associated challenges:
X-ray crystallography challenges:
Optimization of protein expression and purification conditions to obtain protein quantities sufficient for crystallization (10-50 mg)
Identification of suitable detergents for membrane-associated domains
Screening hundreds of crystallization conditions (systematic approach using factorial designs)
Managing protein flexibility that may impede crystal formation
NMR spectroscopy limitations:
Size constraints, as the 516-amino acid YlaB exceeds typical limits for traditional NMR approaches
Need for isotopic labeling (15N, 13C, 2H) requiring specialized expression systems
Development of domain-focused approaches for regions of particular interest
Data processing and structural calculation complexity
Cryo-electron microscopy considerations:
Sample preparation optimization to ensure homogeneity
Protein concentration and vitrification conditions
Particle picking and classification challenges
Resolution limitations for smaller proteins like YlaB
Integrative structural biology approaches:
Combination of low-resolution techniques (SAXS, SANS) with computational modeling
Application of crosslinking mass spectrometry to obtain distance constraints
Hydrogen-deuterium exchange mass spectrometry for dynamics information
Use of AlphaFold2 or similar prediction tools as starting models for refinement
Statistical validation of structural data is essential, including R-factors for crystallography, NOE violations for NMR, and resolution statistics for cryo-EM. Researchers should implement randomized experimental designs when conducting structural studies to minimize systematic errors and maximize reproducibility .
Investigating the relationship between YlaB (PdeB) and bacterial biofilm formation requires systematic experimentation across multiple scales, from molecular to community levels. An effective experimental strategy should include:
Genetic manipulation approaches:
Construction of clean deletion mutants using lambda Red recombination or CRISPR-Cas9
Complementation with wild-type and point-mutated YlaB variants
Development of inducible expression systems for dose-dependent studies
Creation of reporter fusions to monitor YlaB expression during biofilm development
Quantitative biofilm assays:
Static microtiter plate assays with crystal violet staining
Flow cell systems for dynamic biofilm formation
Confocal laser scanning microscopy with fluorescent reporters
Biomass and biofilm architecture quantification using COMSTAT or similar software
Molecular mechanism studies:
Measurement of cyclic di-GMP levels in biofilm vs. planktonic cells
Identification of YlaB-dependent exopolysaccharide production
Analysis of transcriptional profiles during biofilm development
Investigation of protein-protein interactions in biofilm context
Experimental design considerations:
Statistical analysis should include ANOVA for comparing biofilm formation across multiple strains and conditions, with post-hoc tests for specific comparisons. Multivariate analyses may be appropriate for integrating multiple biofilm parameters. Power analysis should be conducted to ensure sufficient sample sizes for detecting biologically meaningful differences in biofilm formation .
Optimizing expression and purification of recombinant YlaB protein requires careful consideration of multiple factors to ensure high yield, purity, and biological activity. Based on current protocols, the following methodology is recommended:
Expression system optimization:
Host strain: E. coli BL21(DE3) or derivatives show good results for YlaB expression
Vector selection: pET-based vectors with T7 promoter and N-terminal His-tag
Induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours)
Media formulation: Test rich media (LB, TB) versus defined media for optimal expression
Consider a factorial design experiment to identify optimal combinations of these factors
Purification strategy:
Primary capture: Immobilized metal affinity chromatography (IMAC) with Ni-NTA resin
Intermediate purification: Ion exchange chromatography
Polishing step: Size exclusion chromatography
Buffer optimization: Test various buffer compositions, pH values, and salt concentrations
Protein stability enhancers: Consider adding glycerol, reducing agents, or specific metal ions
Quality control measures:
SDS-PAGE analysis: Verify >90% purity
Western blotting: Confirm identity with anti-His antibodies
Activity assays: Verify functional phosphodiesterase activity
Mass spectrometry: Confirm protein identity and detect potential modifications
Dynamic light scattering: Assess homogeneity and aggregation state
Storage and stability:
The experimental design should include control proteins expressed and purified under identical conditions and statistical analysis of yield and purity across multiple purification batches to ensure reproducibility .
Investigating YlaB protein-protein interactions requires a multi-faceted approach to identify, validate, and characterize interaction partners. The following methodological strategies are recommended:
In vivo interaction identification methods:
Bacterial two-hybrid (B2H) system: Fuse YlaB to one domain of a split transcription factor and potential partners to the complementary domain
Protein-fragment complementation assays: Split-GFP or split-luciferase fusions
Crosslinking coupled with mass spectrometry (XL-MS): In vivo crosslinking followed by affinity purification and MS identification
Design controls including non-interacting protein pairs and known interacting pairs
Affinity-based approaches:
Co-immunoprecipitation with anti-YlaB antibodies or epitope tags
Tandem affinity purification (TAP) with dual-tagged YlaB
Pull-down assays with His-tagged YlaB as bait
Implement randomized block design to account for batch effects
Include appropriate negative controls and competition assays to verify specificity
Biophysical interaction characterization:
Surface plasmon resonance (SPR) for kinetic and affinity measurements
Isothermal titration calorimetry (ITC) for thermodynamic parameters
Microscale thermophoresis (MST) for interaction in solution
Bio-layer interferometry (BLI) for real-time interaction analysis
Design concentration gradients and replicate measurements for robust curve fitting
Structural studies of complexes:
Statistical analysis should include assessment of interaction significance versus background, determination of dissociation constants with confidence intervals, and comparison of interaction profiles across different experimental conditions .
Experimental design considerations for robust analysis:
Implement nested designs with technical replicates within biological replicates
Include standard curves with known phosphodiesterase enzymes
Establish appropriate negative controls (heat-inactivated enzyme, catalytic mutants)
Apply randomized block design to control for batch effects in reagents and instrumentation
Data preprocessing and quality control:
Evaluate raw data for outliers using statistical tests (Grubbs' test, Dixon's Q test)
Assess normality using Shapiro-Wilk or Kolmogorov-Smirnov tests
Transform data if necessary (log transformation for enzymatic data often appropriate)
Calculate coefficients of variation for technical replicates (<15% typically acceptable)
Statistical analysis methods:
For comparison across conditions: ANOVA with appropriate post-hoc tests
For enzyme kinetics: Non-linear regression for Michaelis-Menten parameters
For inhibition studies: IC50 determination with confidence intervals
For time-course experiments: Repeated measures ANOVA or mixed-effects models
| Analysis Type | Appropriate Statistical Method | Key Parameters |
|---|---|---|
| Enzyme Kinetics | Non-linear regression | K<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub> |
| Condition Comparison | One-way or factorial ANOVA | F-statistic, p-value, effect size |
| Inhibition Analysis | Four-parameter logistic regression | IC<sub>50</sub>, Hill slope |
| Temperature/pH Effects | Second-order polynomial fits | Optimal conditions, stability range |
Advanced analytical approaches:
Visualization recommendations:
All statistical analyses should report both statistical significance and effect sizes, with appropriate error bars (preferably 95% confidence intervals rather than standard error). P-values should be adjusted for multiple comparisons using methods such as Bonferroni or Benjamini-Hochberg procedures .
Based on current knowledge about YlaB (PdeB) in E. coli, several promising research directions emerge for advancing our understanding of this protein's function and significance. Researchers should consider prioritizing:
Structural biology approaches:
Determination of high-resolution structures of YlaB alone and in complex with substrates
Identification of critical catalytic residues and regulatory domains
Comparison with other phosphodiesterases to understand evolutionary relationships
Structure-guided design of specific inhibitors as research tools
Systems biology integration:
Physiological relevance studies:
Methodological innovations:
Development of real-time sensors for monitoring YlaB activity in vivo
Application of cryo-electron tomography for visualizing YlaB in its native context
Implementation of CRISPR interference for precise temporal control of YlaB expression
Adaptation of microfluidic systems for single-cell analysis of YlaB function
Future experimental designs should emphasize integration across these areas, combining structural insights with functional studies and systems-level approaches. Latin Square and Randomized Block Designs will be particularly valuable for efficiently exploring multiple variables while controlling for experimental noise .
Integrating computational approaches with experimental studies of YlaB creates powerful synergies for accelerating research progress and generating novel hypotheses. A comprehensive integration strategy should include:
Structural prediction and analysis:
Apply AlphaFold2 or RoseTTAFold for generating high-confidence structural models
Use molecular dynamics simulations to study conformational dynamics
Perform virtual screening for potential substrates or inhibitors
Guide experimental design by identifying critical residues for mutagenesis
Validate computational predictions with experimental structural data
Network analysis and systems biology:
Construct gene regulatory networks incorporating YlaB
Identify potential transcription factors controlling YlaB expression
Predict metabolic impacts of YlaB activity using flux balance analysis
Model cyclic di-GMP signaling dynamics with ordinary differential equations
Design factorial experiments to test computational predictions
Advanced data analysis methods:
Apply machine learning for pattern recognition in YlaB activity datasets
Use Bayesian statistics for incorporating prior knowledge into new findings
Implement principal component analysis for dimensionality reduction
Develop custom algorithms for analyzing high-throughput YlaB functional screens
Design statistically rigorous validation experiments for computational hypotheses
Integrated research workflow:
| Computational Approach | Experimental Validation | Integration Strategy |
|---|---|---|
| Structural prediction | Site-directed mutagenesis | Target predicted functional residues |
| Molecular docking | Binding assays | Test top-ranked predicted ligands |
| Network inference | Gene knockouts | Validate predicted regulatory connections |
| Dynamics simulation | FRET sensors | Monitor predicted conformational changes |
| Evolution analysis | Complementation with homologs | Test functional conservation |
By implementing this integrated approach, researchers can establish virtuous cycles where computational predictions guide experimental design, and experimental results refine computational models. This iterative process accelerates discovery while maximizing resource efficiency. Experimental designs should incorporate appropriate controls to validate computational predictions and statistical analyses to quantify agreement between predicted and observed outcomes .
Accelerating YlaB research requires methodological innovations across multiple technical domains. The following advances would significantly enhance research capabilities:
High-throughput functional assays:
Development of fluorescent or luminescent reporters for real-time monitoring of YlaB activity
Adaptation of phosphodiesterase assays to microplate formats for increased throughput
Creation of cell-based screens for YlaB function in various genetic backgrounds
Implementation of Latin Square Design for efficient screening of multiple variables simultaneously
Advanced imaging technologies:
Single-molecule localization microscopy to track YlaB dynamics in living cells
Correlative light and electron microscopy to connect YlaB localization with ultrastructural features
Super-resolution microscopy to visualize YlaB within bacterial signaling complexes
Fluorescence lifetime imaging to detect YlaB protein-protein interactions in vivo
Genetic and protein engineering tools:
CRISPR interference systems for precise temporal control of YlaB expression
Split-protein complementation systems optimized for YlaB interaction studies
Synthetic biology approaches to rewire YlaB regulatory networks
Genetically encoded biosensors for cyclic di-GMP to monitor YlaB activity in real-time
Structural biology innovations:
Application of cryo-electron tomography for visualizing YlaB in its native cellular context
Development of nanobodies or synthetic binding proteins as crystallization chaperones
Microcrystal electron diffraction for structure determination from sub-micron crystals
Hydrogen-deuterium exchange mass spectrometry workflows optimized for membrane-associated proteins
Data integration frameworks:
Development of specialized databases for cyclic di-GMP signaling components
Machine learning approaches for predicting YlaB interaction partners
Computational pipelines integrating transcriptomic, proteomic, and metabolomic data
Standardized data reporting formats to facilitate meta-analyses across studies
These methodological advances should be implemented within robust experimental designs that incorporate appropriate controls, randomization, and statistical power analysis. Randomized Block Designs would be particularly valuable for evaluating new methods against established techniques while controlling for experimental variables .