Recombinant Escherichia coli Uncharacterized protein yniB (yniB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. We recommend adding 5–50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
yniB; b1726; JW1715; Uncharacterized protein YniB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yniB
Target Protein Sequence
MTYQQAGRIAVLKRILGWVIFIPALISTLISLLKFMNTRQENKEGINAVMLDFTHVMIDM MQANTPFLNLFWYNSPTPNFNGGVNVMFWVIFILIFVGLALQDSGARMSRQARFLREGVE DQLILEKAKGEEGLTREQIESRIVVPHHTIFLQFFSLYILPVICIAAGYVFFSLLGFI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the subcellular localization of yniB?

yniB has been characterized as an integral inner membrane protein in E. coli . According to STEPdb (Subcellular Topology of E. coli Proteins database), yniB is classified under the subcellular location code "B," which denotes integral inner membrane proteins . Experimental evidence suggests it is inserted into the membrane via the SEC translocon pathway, as indicated by its classification as "integral IM protein (SEC in IM)" in multiple databases .

Are there any known structural features of yniB?

While the three-dimensional structure of yniB has not been experimentally determined, sequence analysis suggests it contains multiple transmembrane helices characteristic of inner membrane proteins . The protein does not appear to contain disulfide bonds based on analysis by Loos et al. (2019), which is consistent with its predicted membrane localization, as the reducing environment of the cytoplasm and inner membrane typically disfavors disulfide bond formation .

What recombinant forms of yniB are available for research?

Recombinant full-length E. coli uncharacterized protein yniB is available as a His-tagged protein expressed in E. coli . The commercial preparations typically contain:

PropertySpecification
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-178)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

For experimental applications, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What detection methods can be used to study yniB expression?

For detecting yniB in experimental settings, researchers can employ several approaches:

  • Western Blotting: Anti-yniB polyclonal antibodies raised in rabbits against recombinant E. coli K12 yniB protein are available for immunodetection . These antibodies have been tested for Western blot applications and ELISA .

  • ELISA: Commercial ELISA kits utilizing recombinant yniB as standards allow for quantitative detection .

  • SDS-PAGE: For purified recombinant protein, standard SDS-PAGE can be used to verify protein integrity and purity .

For membrane proteins like yniB, specialized extraction protocols using detergents are necessary before applying these detection methods. When designing experiments, it's important to consider that the hydrophobic nature of membrane proteins may affect their migration patterns in SDS-PAGE and their antigenicity in immunodetection methods.

What are the recommended storage and handling conditions for recombinant yniB?

For optimal stability and activity of recombinant yniB protein:

  • Storage Temperature: Store at -20°C/-80°C upon receipt .

  • Aliquoting: Divide into working aliquots to avoid repeated freeze-thaw cycles .

  • Short-term Storage: Working aliquots can be stored at 4°C for up to one week .

  • Reconstitution: Briefly centrifuge vials prior to opening to bring contents to the bottom. Reconstitute in deionized sterile water to 0.1-1.0 mg/mL .

  • Freeze-Thaw: Repeated freezing and thawing is not recommended as it may affect protein integrity .

The shelf life of liquid formulations is typically 6 months at -20°C/-80°C, while lyophilized forms can maintain stability for up to 12 months under proper storage conditions .

What is known about the function of yniB?

Despite being identified in the well-studied E. coli K12 genome, the function of yniB remains largely uncharacterized . It is described as a "hypothetical protein; predicted inner membrane protein Function unknown" in the EcoliWiki database . The lack of functional annotation suggests it has not been extensively studied through direct experimental approaches.

The protein belongs to a category of hypothetical proteins that have been confirmed at the protein level but whose biochemical roles remain to be elucidated through targeted functional studies. Understanding the function of such uncharacterized proteins represents an important frontier in completing our knowledge of bacterial physiology.

What protein-protein interactions have been predicted for yniB?

According to the STRING protein interaction database, yniB has several predicted functional partners :

ProteinDescriptionSTRING Interaction Score
ybaMDUF2496 family protein0.537
yfjDUPF0053 family inner membrane protein; Putative membrane protein0.535
yniC2-deoxyglucose-6-P phosphatase; Sugar-phosphate phosphohydrolase0.525
sufESulfur acceptor protein0.517
mokBRegulatory peptide0.511
ydbLDUF1318 family protein0.509
ydfOQin prophage; uncharacterized protein0.475
ymgGUPF0757 family protein0.471

These interactions are based on computational prediction methods including neighborhood, gene fusion, cooccurrence, coexpression, experimental evidence, database annotations, text mining, and homology . The proximity to yniC, which has phosphatase activity, and sufE, involved in sulfur metabolism, might provide clues to potential metabolic roles of yniB.

How can researchers determine the function of uncharacterized proteins like yniB?

A comprehensive approach to characterizing function of proteins like yniB typically involves:

  • Comparative Genomics: Analyzing gene neighborhood and conservation patterns across species can provide functional hints. For yniB, examining its conservation in other enterobacteria and its genomic context may yield insights .

  • Phenotypic Analysis: Creating knockout mutants (Δ_yniB_) and comparing growth under various conditions to wild-type strains. Complementation studies can confirm observed phenotypes.

  • Transcriptomic/Proteomic Profiling: Analyzing changes in gene/protein expression patterns when yniB is deleted or overexpressed may reveal pathways it influences.

  • Protein-Protein Interaction Studies: Experimental validation of predicted interactions through co-immunoprecipitation, bacterial two-hybrid systems, or cross-linking studies.

  • Biochemical Characterization: Purifying the protein and testing for specific enzymatic activities based on bioinformatic predictions or structural similarities.

  • Structural Analysis: Determining the three-dimensional structure through X-ray crystallography, NMR, or cryo-EM to identify potential active sites or binding pockets.

For membrane proteins like yniB, specialized approaches such as membrane yeast two-hybrid systems or blue native PAGE may be more appropriate for interaction studies.

What challenges exist in working with membrane proteins like yniB?

Membrane proteins present several unique challenges in experimental research:

  • Solubilization and Purification: The hydrophobic nature of membrane proteins like yniB requires careful selection of detergents or amphipols to maintain proper folding while extracting from the membrane.

  • Structural Studies: Traditional structural biology techniques often struggle with membrane proteins. For yniB research, newer approaches like lipidic cubic phase crystallization or detergent-free systems may prove beneficial.

  • Functional Assays: Designing appropriate functional assays requires understanding the protein's native membrane environment. Reconstitution into liposomes or nanodiscs may be necessary to observe native-like activity.

  • Expression Systems: Heterologous expression of membrane proteins often leads to toxicity, misfolding, or inclusion body formation. For yniB studies, optimization of expression conditions or the use of specialized expression hosts may be required.

When designing experiments with yniB, researchers should consider incorporating appropriate controls for membrane protein handling and ensure that fusion tags (such as the His-tag) do not interfere with localization or function.

How does studying uncharacterized proteins like yniB contribute to systems biology?

Understanding uncharacterized proteins like yniB is crucial for completing the functional annotation of the E. coli genome and building accurate metabolic and regulatory models. Despite decades of research on E. coli K12, approximately 30-35% of its genes still lack experimental characterization or have only predicted functions.

For systems biology approaches, these knowledge gaps present significant challenges:

  • Metabolic Modeling: Uncharacterized proteins may represent missing links in metabolic pathways, leading to incomplete flux balance analysis models.

  • Protein Interaction Networks: Proteins like yniB with unknown functions create "dark matter" in interactome maps, potentially obscuring important regulatory hubs or functional modules.

  • Evolutionary Analysis: Understanding conservation patterns of uncharacterized proteins across species can reveal fundamental biological processes that have been overlooked.

By characterizing yniB and similar proteins, researchers contribute to the completion of the E. coli functional genome and enhance the predictive power of systems biology models.

What experimental design considerations should be made when studying proteins of unknown function?

When designing experiments to study uncharacterized proteins like yniB, several methodological considerations can maximize research effectiveness:

  • Control Selection: Include appropriate positive and negative controls based on predicted function or localization. For membrane proteins like yniB, well-characterized inner membrane proteins of similar size can serve as controls.

  • Validation Across Methods: Employ multiple complementary techniques to build confidence in observations. For example, combine computational predictions, genetic approaches, and biochemical assays to triangulate function.

  • Minimizing Confounding Variables: When studying a protein of unknown function, controlling experimental variables becomes crucial. Standardizing growth conditions, strain backgrounds, and experimental procedures helps isolate the protein's specific effects .

  • Statistical Power: Design experiments with sufficient replication to detect potentially subtle phenotypes. For uncharacterized proteins, effect sizes may be smaller than expected, requiring robust statistical approaches .

  • Negative Results Documentation: For uncharacterized proteins, negative results (what the protein does not do) are valuable data points that should be documented to guide future research directions.

Careful experimental design that incorporates these considerations can significantly enhance the chances of successfully characterizing yniB's function while minimizing resources expended on unproductive approaches.

What genomic and evolutionary insights might be gained from studying yniB?

Comparative genomic analysis of yniB can provide valuable insights into its evolutionary history and potential function:

  • Conservation Analysis: Determining whether yniB is widely conserved across bacterial species or limited to certain lineages can indicate its fundamental importance.

  • Synteny Analysis: Examining the conservation of genomic context around yniB across related bacteria may reveal functional associations with neighboring genes.

  • Selective Pressure: Analyzing the ratio of synonymous to non-synonymous mutations (Ka/Ks ratio) in yniB across bacterial species can indicate whether it is under purifying, neutral, or positive selection.

Such evolutionary analyses can complement experimental approaches and provide direction for targeted functional studies.

How might structural biology approaches help characterize yniB?

For uncharacterized membrane proteins like yniB, structural determination can provide crucial insights:

  • Fold Recognition: Identifying structural motifs or folds similar to characterized proteins can suggest potential functions.

  • Binding Site Prediction: Identifying putative binding pockets or catalytic sites through structural analysis can guide biochemical assays.

  • Protein-Protein Interaction Interfaces: Structural data can reveal potential interfaces for interaction with predicted partners like ybaM or yfjD.

  • Membrane Topology: Determining the precise arrangement of transmembrane domains and their orientation in the membrane can inform functional hypotheses.

Recent advances in cryo-electron microscopy and integrative structural biology approaches have made membrane protein structure determination more accessible, offering new opportunities for characterizing proteins like yniB.

What systems-level approaches might reveal yniB function?

Beyond targeted studies of yniB itself, systems-level approaches may help place it in a broader biological context:

  • Synthetic Genetic Arrays: Systematic genetic interaction mapping by creating double mutants with yniB deletion and other E. coli genes can reveal functional relationships.

  • Metabolomics Profiling: Comparing metabolite profiles between wild-type and yniB mutant strains under various conditions may identify affected metabolic pathways.

  • Condition-Specific Essentiality: Testing the importance of yniB under hundreds of growth conditions using high-throughput phenotyping can identify specific scenarios where its function becomes critical.

  • Multi-omics Integration: Combining transcriptomic, proteomic, and metabolomic data from yniB mutants can provide a comprehensive view of its impact on cellular physiology.

These approaches offer the potential to uncover the function of yniB even in the absence of clear homology to characterized proteins or obvious phenotypes under standard laboratory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.