Recombinant Escherichia coli Uncharacterized protein yqgA (yqgA)

Shipped with Ice Packs
In Stock

Description

Overview of Uncharacterized Proteins

Escherichia coli, despite being one of the most thoroughly studied organisms in microbiology, still contains numerous proteins with unknown or poorly defined functions. These uncharacterized proteins, often designated with "y" prefixes in their gene names, represent significant knowledge gaps in our understanding of bacterial physiology. Recent research has made considerable progress in characterizing previously unknown proteins through advanced genomic, proteomic, and computational approaches. In particular, studies have successfully identified functions for several previously uncharacterized transcription factors in E. coli, demonstrating the value of systematic approaches to protein characterization .

Significance of Studying Uncharacterized Proteins

The characterization of proteins like YqgA is not merely an academic exercise but has profound implications for understanding bacterial adaptation, survival mechanisms, and potential biotechnological applications. Uncharacterized proteins may play crucial roles in stress responses, antibiotic resistance, or metabolic processes that remain undiscovered. For instance, research has revealed that some previously uncharacterized proteins serve as transcription factors regulating important cellular processes, with some having global regulatory effects while others function as local regulators affecting specific pathways .

Current State of Research on YqgA

Unlike some other uncharacterized proteins in E. coli, specific research on YqgA remains limited. While extensive studies have been conducted on related proteins such as YqhA, which has been characterized as a UPF0114 family protein with a defined amino acid sequence and structural features , and YqjA, which plays significant roles in alkaline pH homeostasis and osmosensing , YqgA has not received similar attention in the literature. This presents both a challenge and an opportunity for researchers interested in expanding the functional characterization of the E. coli proteome.

Predicted Functions

Prediction of protein function often employs bioinformatic approaches, including sequence homology, conserved domain analysis, and structural modeling. These approaches have been successfully applied to other uncharacterized proteins in E. coli. For instance, YqjA was eventually characterized as a member of the DedA/Tvp38 protein family and found to play a role in proton-dependent transport and alkaline pH homeostasis . Similar approaches could potentially yield insights into YqgA's function.

Comparison with Similar Uncharacterized Proteins

The methodology used to characterize other E. coli proteins provides valuable insights for studying YqgA. For example, researchers have employed multiplexed chromatin immunoprecipitation combined with lambda exonuclease digestion (multiplexed ChIP-exo) to identify DNA binding sites for previously uncharacterized transcription factors . This approach successfully characterized 34 out of 40 candidate proteins as DNA-binding proteins. Similar experimental strategies could be applied to determine if YqgA has DNA-binding properties or other functional characteristics.

Expression Systems

Recombinant expression of bacterial proteins typically employs E. coli-based expression systems, particularly for E. coli proteins themselves. For production of recombinant proteins similar to YqgA, researchers typically use expression vectors that allow for controlled induction and the addition of affinity tags to facilitate purification. As demonstrated with the production of recombinant YqhA, E. coli serves as an effective expression host for its own proteins . The production of YqgA would likely employ similar methodologies, utilizing vectors with appropriate promoters and affinity tags.

Purification Methods

Standard purification techniques for recombinant proteins include affinity chromatography, typically utilizing His-tags or other fusion tags. For example, recombinant YqhA is produced with an N-terminal His-tag to facilitate purification . Following initial purification, additional steps such as size exclusion chromatography or ion exchange chromatography may be employed to achieve higher purity. The purified protein is often provided in a lyophilized form with appropriate storage buffers to maintain stability .

Purification ParameterTypical ProtocolNotes
Affinity TagHis-tag (N-terminal)Facilitates purification via Ni-NTA chromatography
Buffer CompositionTris/PBS-based, pH 8.0Often includes stabilizing agents like trehalose
Storage FormLyophilized powderEnhances stability for shipping and long-term storage
ReconstitutionDeionized sterile waterRecommended concentration: 0.1-1.0 mg/mL
Storage Conditions-20°C/-80°CAliquoting recommended to avoid freeze-thaw cycles

Challenges in Recombinant Production

The production of uncharacterized membrane proteins presents distinct challenges. Many uncharacterized proteins in E. coli, including those in the DedA/Tvp38 family like YqjA, are membrane proteins . If YqgA is also a membrane protein, its production would face challenges related to proper folding, solubility, and maintaining native conformation during purification. Strategies to address these challenges include the use of mild detergents, specialized expression strains, and optimized induction conditions.

Bioinformatic Predictions

Modern bioinformatic approaches can provide valuable insights into potential functions of uncharacterized proteins. These methods include sequence homology searches, identification of conserved domains, structural modeling, and analysis of genomic context. For instance, if YqgA is located in proximity to genes with known functions, this could provide clues to its potential role. This approach has been successful with other uncharacterized proteins; for example, YqhC was found to regulate the transcription of adjacent genes encoding NADPH-dependent furfural oxidoreductases .

Comparative Analysis with Characterized Proteins

Insights into YqgA's function could potentially be gleaned from better-characterized proteins with similar features. For example, YqjA was found to be critical for E. coli survival at alkaline pH (8.5 to 9.5) and appears to function as an osmosensing cation-dependent proton transporter . If YqgA shares structural similarities with proteins like YqjA, it might also be involved in membrane transport or pH homeostasis, though this would require experimental validation.

Limitations in Current Knowledge

The most significant limitation in our understanding of YqgA is the scarcity of specific experimental data. While methodologies exist for characterizing uncharacterized proteins, and these have been successfully applied to proteins like YqjA and YqhA, similar comprehensive studies focusing specifically on YqgA appear to be lacking in the current literature. This represents a notable gap in our understanding of the E. coli proteome.

Promising Research Approaches

Future research on YqgA could benefit from multi-omics approaches that combine genomics, transcriptomics, proteomics, and metabolomics. High-throughput methods such as multiplexed ChIP-exo have proven valuable for characterizing uncharacterized transcription factors . Additionally, phenotypic analysis of deletion mutants, as performed for genes like yfeC, yciT, ybcM, and ygbI , could provide insights into YqgA's function. Structural studies using X-ray crystallography or cryo-electron microscopy could also illuminate YqgA's molecular architecture and potential functional mechanisms.

Research ApproachMethodologyExpected Outcome
Genomic Context AnalysisBioinformatic analysis of adjacent genesPotential functional associations
Deletion Mutant PhenotypingCreation and analysis of ΔyqgA strainsPhysiological role assessment
Protein-Protein Interaction StudiesCo-immunoprecipitation, yeast two-hybridIdentification of interacting partners
Structural AnalysisX-ray crystallography, cryo-EMMolecular structure determination
Localization StudiesFluorescent protein taggingCellular localization patterns

Potential Applications

Characterizing YqgA could have various applications, particularly if it plays roles in stress response, adaptation to environmental conditions, or metabolic processes. For comparison, the characterization of YqjA revealed its importance in alkaline pH tolerance , while YqhC was found to regulate genes involved in furfural oxidoreduction, which has implications for biofuel production . Similarly, discovering YqgA's function could potentially lead to applications in biotechnology, synthetic biology, or understanding bacterial adaptation mechanisms.

Product Specs

Form
Lyophilized powder
Note: We typically ship the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents are at the bottom. Reconstitute the protein with deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag whenever possible.
Synonyms
yqgA; b2966; JW2934; Uncharacterized protein YqgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yqgA
Target Protein Sequence
MVIGPFINASAVLLGGVLGALLSQRLPERIRVSMTSIFGLASLGIGILLVVKCANLPAMV LATLLGALIGEICLLEKGVNTAVAKAQNLFRHSRKKPAHESFIQNYVAIIVLFCASGTGI FGAMNEGMTGDPSILIAKSFLDFFTAMIFACSLGIAVSVISIPLLIIQLTLAWAAALILP LTTPSMMADFSAVGGLLLLATGLRICGIKMFPVVNMLPALLLAMPLSAAWTAWFA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the function of YqgA in Escherichia coli?

YqgA belongs to the broader category of uncharacterized proteins in E. coli. While direct functional characterization is limited, comparative genomic analyses suggest it may be part of protein families involved in bacterial adaptation mechanisms. Similar to characterized proteins such as RpnA-E (YhgA-like proteins), YqgA may participate in DNA-mobilizing processes that facilitate environmental niche adaptation through horizontal gene transfer . The specific biochemical activity remains to be fully elucidated, though structural predictions can provide initial functional hypotheses for experimental validation.

How does YqgA compare structurally to characterized proteins in E. coli?

While specific structural data for YqgA is limited, researchers can perform comparative structural analyses with better-characterized E. coli proteins. For example, the YhgA-like family of proteins (now designated as RpnA-E) contains distinctive structural motifs associated with nuclease activity . Similarly, YjeQ proteins display a unique domain architecture with an OB-fold RNA-binding domain, a centrally permuted GTPase module, and a zinc knuckle-like C-terminal cysteine cluster . By comparing conserved domains and structural motifs, researchers can develop initial hypotheses about YqgA's potential function and biochemical properties.

What expression systems are most suitable for recombinant YqgA production?

Based on studies of recombinant protein production in E. coli, approximately 50% of recombinant proteins fail to be expressed in various host cells . For uncharacterized proteins like YqgA, the accessibility of translation initiation sites is critical for successful expression. When designing expression systems, researchers should consider:

Expression System ComponentOptimization StrategyImpact on Expression
Translation initiation siteModify first 9 codons with synonymous substitutionsIncreases mRNA accessibility and expression levels
Promoter selectionUse inducible promoters with tight regulationControls expression timing and prevents toxicity
Host strainSelect strains lacking endogenous proteasesReduces degradation of target protein
Growth conditionsOptimize temperature, media composition, and induction timingIncreases yield and solubility

Implementing the TIsigner approach, which uses simulated annealing to modify the first nine codons of mRNAs with synonymous substitutions, can significantly improve expression success rates .

How should researchers design experiments to characterize YqgA's biochemical properties?

Characterizing an uncharacterized protein like YqgA requires a systematic approach similar to that used for YjeQ and YqhD proteins . The experimental workflow should include:

  • Sequence-based prediction of potential functions and activities

  • Recombinant protein expression and purification to homogeneity

  • Biochemical assays to test predicted activities:

    • If nuclease activity is predicted (like RpnA), test for magnesium-dependent endonuclease activity with various DNA substrates

    • If enzymatic activity is predicted, perform substrate screening assays

  • Structural studies (X-ray crystallography, cryo-EM) to determine protein folding and active sites

  • Interaction studies (pull-down assays, co-immunoprecipitation) to identify binding partners

Researchers should design controls carefully, including site-directed mutants of predicted active site residues to validate biochemical findings.

What approaches are effective for studying the physiological role of YqgA in E. coli?

To determine the physiological significance of YqgA, researchers should employ a multi-faceted approach:

  • Generate yqgA knockout strains and characterize their phenotypes under various growth conditions

  • Perform transcriptomic and proteomic analyses to identify pathways affected by yqgA deletion

  • Use Adaptive Laboratory Evolution (ALE) to identify conditions where YqgA confers a selective advantage

  • Conduct complementation studies with yqgA variants to identify critical functional domains

  • Evaluate stress responses (oxidative, membrane, translational) in wildtype versus knockout strains

This approach has been effective for characterizing proteins like YqhD, which was found to be involved in bacterial response to compounds that generate membrane lipid peroxidation .

How can researchers design effective knockout and complementation experiments for YqgA?

Designing knockout and complementation experiments requires careful consideration:

  • Genetic manipulation strategy:

    • Use precise genome editing techniques (CRISPR-Cas9, λ-Red recombination) to avoid polar effects

    • Design deletion constructs that maintain reading frame of surrounding genes

    • Consider inducible knockdown systems if complete deletion is lethal

  • Phenotypic assessment:

    • Test growth under various stress conditions (oxidative, membrane, temperature)

    • Measure specific cellular processes that might involve YqgA

    • Conduct competition assays to detect subtle fitness differences

  • Complementation controls:

    • Express wildtype YqgA from different promoters to test dosage effects

    • Create point mutants in predicted functional domains

    • Use plasmid systems with different copy numbers to control expression levels

For example, when studying YqhD, researchers discovered its role by testing knockout strains against compounds that generate reactive oxygen species and lipid peroxidation .

How should researchers interpret contradictory results from different prediction tools for YqgA function?

When different computational prediction tools yield contradictory results for uncharacterized proteins like YqgA:

  • Evaluate the underlying algorithms and databases of each prediction tool

  • Consider the evolutionary conservation patterns across different bacterial species

  • Weigh predictions from tools specific to bacterial proteins more heavily

  • Integrate multiple lines of evidence:

    • Sequence homology with characterized proteins

    • Structural predictions and domain architecture

    • Genomic context and operon structure

    • Phylogenetic distribution patterns

  • Validate predictions experimentally, starting with the most strongly supported hypotheses

Researchers faced similar challenges with YhgA-like proteins, which were initially annotated as transposase_31 (Pfam PF04754) proteins but were later experimentally characterized as DNA nucleases involved in horizontal gene transfer .

What statistical approaches are appropriate for analyzing YqgA expression data?

When analyzing expression data for YqgA:

  • For RNA-seq or qPCR data:

    • Use DESeq2 or edgeR for differential expression analysis

    • Apply appropriate normalization methods for RNA-seq count data

    • Include technical and biological replicates (minimum n=3)

  • For protein expression quantification:

    • Use appropriate statistical tests (t-test, ANOVA) with multiple testing correction

    • Account for batch effects in experimental design

    • Consider non-parametric tests if normality assumptions are violated

  • For meta-analysis across multiple experiments:

    • Use random-effects models to account for inter-study heterogeneity

    • Apply standardized mean difference (SMD) to compare across different measurement scales

    • Report confidence intervals alongside p-values

Similar approaches have been successfully applied in meta-analyses of aggregated Adaptive Laboratory Evolution data from E. coli experiments, which analyzed 13,957 mutations across 357 independent evolutions .

How can researchers distinguish between direct and indirect effects when studying YqgA's impact on cellular processes?

Distinguishing direct from indirect effects requires specialized experimental approaches:

  • Time-resolved experiments:

    • Monitor cellular responses at multiple time points after YqgA induction/deletion

    • Early responses are more likely to represent direct effects

  • Interactome analysis:

    • Use techniques like BioID or APEX proximity labeling to identify direct interaction partners

    • Validate interactions with co-immunoprecipitation or yeast two-hybrid assays

  • In vitro reconstitution:

    • Purify YqgA and potential interacting components

    • Reconstitute hypothesized activities in a controlled system

  • Genetic epistasis analysis:

    • Create double knockout strains with genes in hypothesized pathways

    • Analyze phenotypic outcomes to determine pathway relationships

These approaches help construct a causal network of interactions, similar to how YqhD was established as part of a NADPH-dependent response mechanism to lipid peroxidation .

What high-throughput approaches can identify potential substrates or interaction partners of YqgA?

Researchers can employ several high-throughput methodologies:

  • Protein microarray screening:

    • Screen YqgA against arrays of E. coli proteins to identify binding partners

    • Test interaction with nucleic acids of different sequences and structures

  • Metabolomic profiling:

    • Compare metabolite profiles between wildtype and yqgA knockout strains

    • Identify metabolic pathways affected by YqgA absence

  • Chemogenomic screening:

    • Test yqgA knockout strain against libraries of chemical compounds

    • Identify conditions where YqgA provides resistance or sensitivity

  • Synthetic genetic array analysis:

    • Cross yqgA knockout with genome-wide deletion library

    • Identify genetic interactions through growth phenotypes

These approaches have successfully identified functions for previously uncharacterized proteins, such as the discovery that YqhD provides protection against aldehydes derived from lipid oxidation .

How should researchers design site-directed mutagenesis experiments to identify critical residues in YqgA?

Effective site-directed mutagenesis requires strategic planning:

  • Target selection based on:

    • Conserved residues identified through multiple sequence alignments

    • Predicted structural motifs and active sites

    • Homology to characterized proteins with known functional residues

  • Mutation design considerations:

    • Conservative substitutions to test chemical properties (e.g., D→E to maintain charge)

    • Non-conservative substitutions to abolish activity (e.g., D→A to remove charge)

    • Cysteine scanning to test accessibility and potential disulfide formation

  • Experimental validation workflow:

Mutation TypePurposeExpected Outcome
Alanine scanningIdentify essential residuesLoss of function if residue is critical
Conservative substitutionsTest specific chemical propertiesPartial retention of function
Cysteine substitutionsProbe structure and accessibilityDisulfide formation in proximal residues

Similar approaches identified critical residues in YjeQ, where a variant in the G1 motif (S221A) was substantially impaired for GTP hydrolysis, demonstrating the importance of this residue for function .

What approaches can researchers use to study potential post-translational modifications of YqgA?

Investigating post-translational modifications (PTMs) of YqgA requires specialized techniques:

  • Mass spectrometry-based approaches:

    • Use high-resolution MS/MS to identify PTMs

    • Employ enrichment strategies for specific modifications (phosphopeptide enrichment, etc.)

    • Compare PTM profiles under different growth conditions

  • Site-specific mutation of potential modification sites:

    • Create non-modifiable variants (e.g., S→A for phosphorylation sites)

    • Create phosphomimetic mutations (e.g., S→D for phosphorylation)

    • Test functional impact of these mutations

  • In vivo labeling:

    • Use metabolic labeling with isotope-labeled precursors

    • Employ chemical labeling strategies for specific modifications

  • Antibody-based detection:

    • Generate modification-specific antibodies if PTMs are identified

    • Use for Western blotting and immunoprecipitation studies

These approaches can reveal regulatory mechanisms for YqgA function, similar to how post-translational regulation has been demonstrated for other E. coli proteins involved in stress responses.

How can researchers integrate YqgA studies with whole-cell modeling approaches?

Integrating YqgA research with systems biology requires:

  • Multi-omics data integration:

    • Combine transcriptomic, proteomic, and metabolomic datasets

    • Map changes to known cellular pathways and networks

    • Identify condition-specific regulation patterns

  • Constraint-based modeling:

    • Incorporate YqgA and its interactions into genome-scale metabolic models

    • Predict phenotypic consequences of YqgA perturbation

    • Use Flux Balance Analysis to identify metabolic impacts

  • Data-driven strain design:

    • Apply Adaptive Laboratory Evolution principles to optimize YqgA function

    • Identify synergistic genetic modifications based on observed mutation patterns

    • Design strains with enhanced properties based on aggregated data

  • Network analysis:

    • Position YqgA within protein-protein interaction networks

    • Identify potential regulatory influences and downstream targets

    • Calculate centrality measures to assess network importance

This systems-level approach has been successful in data-driven strain design using aggregated ALE data in E. coli, revealing global mutation trends and enabling the design of novel strains with enhanced fitness .

What computational methods are most effective for predicting YqgA function based on sequence and structure?

For predicting YqgA function, researchers should employ:

  • Sequence-based methods:

    • Position-Specific Scoring Matrices (PSSMs) to identify remote homologs

    • Hidden Markov Models (HMMs) trained on protein families

    • Deep learning approaches (AlphaFold, ESMFold) for structure prediction

  • Structure-based approaches:

    • Homology modeling based on structurally characterized proteins

    • Structure-based function prediction (enzyme active site matching)

    • Molecular dynamics simulations to predict conformational changes

  • Genomic context methods:

    • Gene neighborhood analysis to identify functional associations

    • Phylogenetic profiling to identify co-evolving genes

    • Operon prediction to identify co-regulated genes

  • Integration of multiple predictors:

    • Consensus approaches that combine multiple methods

    • Bayesian integration of diverse evidence types

    • Confidence scoring based on agreement between methods

These computational methods have successfully generated testable hypotheses for previously uncharacterized proteins like the YhgA-like family, which were subsequently experimentally validated .

What emerging technologies might advance our understanding of YqgA function in the near future?

Several cutting-edge technologies show promise for uncharacterized protein research:

  • Cryo-electron microscopy advances:

    • Single-particle analysis for high-resolution structural determination

    • In-cell tomography to visualize native protein complexes

    • Time-resolved EM to capture conformational changes

  • CRISPR-based technologies:

    • CRISPRi for fine-tuned gene expression control

    • CRISPR screening to identify genetic interactions

    • Base editing for precise genetic modifications

  • Single-cell approaches:

    • Single-cell proteomics to detect cell-to-cell variability

    • Single-cell transcriptomics to identify condition-specific expression

    • Microfluidic approaches for high-throughput phenotyping

  • Synthetic biology tools:

    • Cell-free expression systems for rapid protein characterization

    • Biosensors for detecting protein activity in real-time

    • Minimal cell systems for studying proteins in simplified contexts

These technologies will enable more precise functional characterization of uncharacterized proteins like YqgA and reveal their roles in bacterial physiology and adaptation.

How can researchers design experiments to test whether YqgA contributes to horizontal gene transfer, similar to Rpn proteins?

To investigate YqgA's potential role in horizontal gene transfer:

  • Conjugation and transformation assays:

    • Compare transfer frequencies in wildtype vs. yqgA knockout strains

    • Measure RecA-independent recombination frequencies

    • Test for DNA endonuclease activity similar to RpnA

  • DNA binding and processing experiments:

    • Test YqgA for magnesium-dependent, calcium-stimulated DNA endonuclease activity

    • Examine sequence specificity of DNA binding and cleavage

    • Assess whether cleavage products can provide priming sites for DNA polymerase

  • In vivo genetic exchanges:

    • Track labeled DNA transfer between bacterial populations

    • Measure frequencies of genomic incorporation of foreign DNA

    • Analyze the structure of recombination junctions

These approaches mirror those used to characterize RpnA-E proteins, which were shown to contribute to a novel RecA-independent recombination mechanism in vivo and displayed magnesium-dependent, calcium-stimulated nonspecific DNA endonuclease activity in vitro .

What experimental designs would best reveal the physiological conditions under which YqgA is most active?

To identify conditions where YqgA is physiologically relevant:

  • Transcriptional profiling:

    • Measure yqgA expression under various stress conditions (oxidative, temperature, nutrient limitation)

    • Identify regulatory elements controlling yqgA expression

    • Compare with expression patterns of genes with known functions

  • Competitive fitness assays:

    • Conduct competition experiments between wildtype and yqgA knockout strains

    • Test various environmental conditions to identify those where YqgA confers advantage

    • Use Adaptive Laboratory Evolution to reveal conditions selecting for yqgA expression

  • Protein activity measurements:

    • Develop assays to measure YqgA activity directly

    • Test activity across different pH, temperature, and ionic conditions

    • Identify cofactors or substrates required for optimal activity

  • Stress response integration:

    • Test for involvement in established stress response pathways

    • Examine genetic interactions with known stress response regulators

    • Measure survival rates under specific stress conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.