Recombinant Escherichia coli Uncharacterized protein yqjD (yqjD)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Escherichia coli Uncharacterized Protein YqjD (yqjD) is a 101-amino-acid protein expressed during the stationary phase of bacterial growth. Initially classified as a hypothetical protein, yqjD has been characterized as an inner membrane-associated ribosome-binding protein with roles in ribosome modulation and stress response. It belongs to the DUF883 domain family and is regulated by the RpoS sigma factor .

Key Properties

PropertyValue
Length101 amino acids (aa 1–101)
Molecular Weight11,051 Da
Subcellular LocalizationInner membrane; single-pass transmembrane protein
SequenceMSKEHTTEHLRAELKSLSDTLEEV LSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDAIAKQTRVAAA RADEYVRENPWTGVGIGAAIGVVLGVLLSR
pI9.1

Challenges:

  • Contamination: Basic nature (pI 9.1) leads to nonspecific binding during IMAC, complicating purification .

Applications:

  • Vaccine Development: Used in antigen design due to its conserved domains .

  • Research Tool: Studied in biofilm formation and ribosome dynamics .

Key Discoveries

  1. Stationary-Phase Activity:

    • Expression peaks at 2 days post-exponential growth, correlating with ribosome stalling .

  2. Paralogous Proteins:

    • ElaB (pI 5.3) and YgaM (pI 8.0): Share ribosome-binding roles but differ in isoelectric points .

  3. Biofilm Studies:

    • Mutant strains show altered biofilm formation, suggesting a role in bacterial persistence .

Polysome Profiling

  • ΔyqjD Mutants: No significant polysome defects observed, unlike ΔyhbY mutants .

Challenges and Future Directions

  1. Functional Elucidation:

    • Mechanism of ribosome inhibition remains unclear; structural studies are needed.

  2. Biotechnological Limitations:

    • Contamination risks during recombinant production require optimized protocols .

  3. Therapeutic Potential:

    • Exploring yqjD as a target for antibiotics disrupting ribosome-membrane interactions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yqjD; b3098; JW3069; Uncharacterized protein YqjD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yqjD
Target Protein Sequence
MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR
Uniprot No.

Target Background

Function
Upon overexpression, this protein inhibits growth.
Database Links
Protein Families
ElaB/YgaM/YqjD family
Subcellular Location
Cell inner membrane; Single-pass membrane protein. Note=Predominantly localized to 1 cell pole in stationary phase, with a few smaller foci elsewhere in the cell; polar localization depends on the minCDE operon.

Q&A

What is YqjD and where is it located in E. coli cells?

YqjD is a protein in Escherichia coli that was previously considered hypothetical but has now been characterized as an inner membrane protein that also binds to ribosomes. Structurally, YqjD possesses a transmembrane motif in its C-terminal region that anchors it to the inner membrane, while its N-terminal region associates with 70S and 100S ribosomes . This dual localization is significant for its functional role in stationary phase cells. Recent research has classified YqjD as part of a group of C-tail anchored membrane proteins that are widely distributed across proteobacteria and some other bacterial phyla .

Experimentally, membrane localization can be verified using subcellular fractionation techniques followed by Western blotting with YqjD-specific antibodies. For ribosome association studies, sucrose gradient centrifugation and co-sedimentation assays have been successfully employed to demonstrate YqjD's interaction with ribosomal subunits.

Does YqjD have any paralogous proteins in E. coli?

Yes, E. coli possesses two paralogous proteins of YqjD: ElaB and YgaM. These three proteins share structural similarities and appear to have related functions in ribosome binding and stationary phase adaptation . All three proteins are expressed and bind to ribosomes in a similar manner to YqjD, suggesting functional redundancy or complementary roles .

The degree of sequence conservation varies across these paralogs, with particular differences in their N-terminal regions. Based on mass spectrometry data, YqjD and ElaB show increased abundance during stationary phase, while YgaM generally has lower abundance and doesn't show the same growth phase-dependent expression pattern . Western blot analysis confirms that YqjD and ElaB are detectable after 4 hours of growth (corresponding to approximately OD600 = 3.0) and their levels remain relatively constant for up to 12 hours (OD600 ~ 5.0) .

How is YqjD expression regulated in E. coli?

YqjD expression is primarily regulated by the stress response sigma factor RpoS (σ⁸) and the transcriptional regulator CsrA, indicating its importance during stationary growth phase and stress conditions . This regulatory pattern is consistent with YqjD's role in ribosome hibernation and stationary phase adaptation.

Mass spectrometry data support this regulation pattern, showing that YqjD expression is minimal during exponential growth and increases significantly as cells enter stationary phase . The protein becomes detectable by Western blotting after approximately 4 hours of growth and maintains stable levels for several hours thereafter .

To study YqjD expression experimentally, researchers can use:

  • Reporter gene fusions (such as yqjD-lacZ) to monitor promoter activity

  • Western blotting with YqjD-specific antibodies at different growth phases

  • qRT-PCR to quantify mRNA levels in various growth conditions

  • Deletion strains for regulatory factors (ΔrpoS, ΔcsrA) to confirm regulatory relationships

What is the primary function of YqjD in E. coli?

YqjD functions as a ribosome hibernation factor that inactivates ribosomes during stationary phase and under stress conditions . This protein inhibits protein synthesis by interacting with the 50S ribosomal subunit and potentially blocking the ribosomal tunnel, similar to the mechanism of antimicrobial peptides and macrolide antibiotics .

Experimental evidence for this function comes from in vitro transcription/translation systems, where adding increasing amounts of purified YqjD inhibits the synthesis of various proteins, including the membrane protein MtlA, the cytosolic protein YchF, and the secretory protein OmpA . The inhibitory effect was concentration-dependent, with complete inhibition observed at relatively low concentrations compared to its paralog ElaB .

The ribosome hibernation function is supported by the observation that overexpression of YqjD leads to inhibition of cell growth, likely due to excessive ribosome inactivation . It has been proposed that YqjD localizes ribosomes to the membrane during stationary phase, which may be part of the hibernation mechanism .

How does YqjD interact with ribosomes to inhibit translation?

YqjD interacts with ribosomes through its N-terminal region, while its C-terminal transmembrane domain anchors it to the inner membrane . Through in vivo site-directed cross-linking combined with mass spectrometry, researchers have shown that YqjD specifically interacts with ribosomal proteins surrounding the ribosomal tunnel exit, including uL22, uL23, uL24, and uL29 on the 50S ribosomal subunit .

The mechanism of translation inhibition involves:

  • Binding of YqjD's N-terminus to the 50S ribosomal subunit

  • Potential insertion into or blocking of the ribosomal peptide tunnel

  • Dimerization via the transmembrane domain, which enhances ribosome binding

In vitro translation assays demonstrate that deleting N-terminal amino acids diminishes YqjD's ability to prevent protein synthesis, confirming the importance of the N-terminus for ribosome inactivation . Surprisingly, deleting the C-terminal transmembrane domain (ΔTM-YqjD) also significantly reduces the inhibitory effect, suggesting that dimerization mediated by the transmembrane domain is crucial for effective ribosome inactivation .

What experimental approaches can be used to study YqjD-ribosome interactions?

To study YqjD-ribosome interactions, researchers can employ several complementary approaches:

  • In vitro translation assays: Using coupled transcription/translation systems with purified ribosomes and increasing concentrations of YqjD to assess inhibitory effects .

  • Site-directed cross-linking: Inserting UV-sensitive amino acid analogs (e.g., para-benzoyl-L-phenylalanine, pBpa) at specific positions in YqjD, followed by UV irradiation and detection of cross-linked products by Western blotting and mass spectrometry .

  • Ribosome binding assays: Incubating purified YqjD variants with isolated ribosomes and analyzing binding through co-sedimentation or pull-down assays .

  • Structural studies: Cryo-electron microscopy of ribosome-YqjD complexes to determine binding sites at high resolution.

  • Mutational analysis: Generating YqjD variants with deletions or point mutations to identify critical residues for ribosome binding and inactivation. For example, research has shown that truncating the N-terminus or deleting the transmembrane domain significantly affects ribosome binding and inactivation .

What is the significance of YqjD dimerization for its function?

YqjD dimerization appears to be critical for its ability to inactivate ribosomes. Research has shown that the transmembrane domain of YqjD contains several conserved glycine residues, which likely facilitate dimerization or oligomerization . When the C-terminal transmembrane domain is deleted (ΔTM-YqjD), YqjD shows significantly reduced ribosome inactivation capability despite retaining some ribosome binding activity .

This suggests that the YqjD-ribosome interaction may be primarily avidity-driven, meaning that each YqjD monomer has relatively low affinity for ribosomes, but high-affinity binding is achieved when two or more YqjD monomers oligomerize . This explains why the ΔTM-YqjD variant fails to inactivate ribosomes effectively despite still binding to them.

The importance of dimerization is further supported by the role of a conserved proline residue (P80) in YqjD. Proline-kinked α-helices can form cage- or funnel-like structures with reduced topological flexibility, which may help orient multiple N-termini in close proximity to the ribosome . It's possible that ribosome inactivation requires the simultaneous binding of both N-termini of the YqjD dimer to a single ribosome .

Experimentally, this can be studied using:

  • Size exclusion chromatography to assess oligomerization state

  • Site-directed mutagenesis of conserved residues in the transmembrane domain

  • Cross-linking studies to capture dimer formation

  • Functional assays comparing wild-type and dimerization-deficient variants

How do the mechanisms of YqjD, ElaB, and YgaM differ in ribosome inactivation?

YqjD:

  • Binds to ribosomal proteins uL22, uL23, uL24, and uL29 surrounding the ribosomal tunnel exit

  • Requires both N-terminal ribosome binding and C-terminal dimerization for effective inactivation

  • Has not been observed to enter deeply into the ribosomal tunnel

  • Shows strong inhibition of in vitro translation at relatively low concentrations

ElaB:

  • Inserts into the ribosomal tunnel and contacts the β-hairpin loop of uL23, which acts as an intra-tunnel nascent chain sensor

  • Mimics antimicrobial peptides in its mechanism

  • Requires higher concentrations than YqjD for complete inhibition of in vitro translation

  • Has lower sequence conservation in its N-terminus compared to YqjD

YgaM:

  • Generally has lower abundance than YqjD and ElaB

  • Less well-characterized than the other two proteins

  • Likely has similar but potentially distinct mechanisms

These differences suggest that while these paralogs share the general function of ribosome hibernation, they may have evolved slightly different mechanisms or may be specialized for different stress conditions or growth phases.

What is the evolutionary conservation of YqjD across bacterial species?

YqjD, ElaB, and YgaM represent a class of ribosome-hibernating proteins that are conserved across all proteobacteria and some other bacterial phyla . This widespread conservation suggests that these proteins play an important evolutionary role in bacterial stress responses and stationary phase adaptation.

The conservation appears to be stronger for the C-terminal transmembrane domain, especially the glycine residues involved in dimerization and the conserved proline residue (P80) that may create a kinked structure important for function . The N-terminal domains show more variability across species and even between the three paralogs in E. coli, suggesting possible diversification of ribosome binding mechanisms or specificity.

To study evolutionary conservation experimentally:

  • Phylogenetic analysis of YqjD homologs across bacterial species

  • Complementation studies with YqjD homologs from different species

  • Domain-swapping experiments between YqjD, ElaB, and YgaM

  • Structural comparison of the N-terminal ribosome-binding domains

How can recombinant YqjD be efficiently expressed and purified for in vitro studies?

For efficient expression and purification of recombinant YqjD, researchers typically use the following approach:

  • Expression system: Construct an expression vector containing the yqjD gene with an N-terminal His-tag (6xHis) in a pBAD24 backbone under control of an arabinose-inducible promoter . The pBAD system allows for tightly controlled expression, which is important since YqjD overexpression can inhibit cell growth.

  • Host strain: Use an E. coli strain suitable for protein expression, such as BL21(DE3) or a derivative. For studying YqjD function, using a ΔyqjD strain as the host can prevent interference from endogenous YqjD.

  • Induction conditions: Grow cells to mid-log phase (OD600 ~0.6) and induce with L-arabinose (typically 0.2%) for 3-4 hours at 30°C rather than 37°C to improve protein folding.

  • Membrane protein extraction: Since YqjD is a membrane protein, use a detergent-based extraction method:

    • Harvest cells and resuspend in buffer containing protease inhibitors

    • Lyse cells using sonication or a French press

    • Separate membrane fraction by ultracentrifugation

    • Solubilize membrane proteins using a mild detergent like n-dodecyl-β-D-maltoside (DDM)

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography to obtain highly pure protein and assess oligomerization state

    • For functional studies, ensure the detergent concentration is kept at or slightly above critical micelle concentration

  • Quality control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry to verify the intact mass

    • Circular dichroism to assess secondary structure

This approach has been successfully used to produce functional YqjD for in vitro translation inhibition assays .

What are the key considerations for designing YqjD mutants to study structure-function relationships?

When designing YqjD mutants to study structure-function relationships, researchers should consider:

  • Functional domains:

    • N-terminal region (residues 1-60): Critical for ribosome binding and inactivation

    • C-terminal transmembrane domain (approximately last 18 residues): Important for membrane anchoring and dimerization

    • Proline residue at position 80 (P80): Potentially creates a kinked structure important for function

  • Types of mutations to consider:

    • N-terminal truncations: Removing 12 or more residues significantly reduces ribosome binding and inactivation

    • C-terminal transmembrane domain deletion (ΔTM): Affects dimerization and ribosome inactivation

    • Conserved residue substitutions: Particularly P80A or P80G to test the importance of the proline kink

    • Site-specific incorporation of cross-linkable amino acids: For example, inserting pBpa at positions 10 or 39 to study interaction partners

  • Experimental design considerations:

    • Include appropriate controls (wild-type YqjD, empty vector)

    • Verify expression levels of mutants by Western blotting

    • Assess membrane localization for mutations that might affect targeting

    • Test dimerization properties using SDS-PAGE (YqjD forms stable dimers even in SDS)

    • Evaluate ribosome binding and inactivation separately to distinguish these functions

  • Mutagenesis approaches:

    • Q5 site-directed mutagenesis for point mutations and small deletions

    • Amber suppression system for incorporating non-canonical amino acids like pBpa

    • Overlap extension PCR for domain swapping with ElaB or YgaM

These considerations have been successfully applied in studies that demonstrated the importance of the N-terminus for ribosome binding, the C-terminus for dimerization, and specific residues for YqjD function .

What in vitro assays can accurately measure YqjD's ribosome hibernation activity?

Several in vitro assays have been developed to measure YqjD's ribosome hibernation activity:

  • Coupled in vitro transcription/translation system:

    • Components: Purified cell extract (cytosolic translation factors) and purified ribosomes

    • Template: Plasmid DNA encoding reporter proteins (e.g., MtlA, YchF, OmpA)

    • Measurement: SDS-PAGE and autoradiography or fluorescence detection of newly synthesized proteins

    • Analysis: Quantification of protein synthesis inhibition at varying YqjD concentrations

  • Ribosome binding assay:

    • Mix purified YqjD variants with isolated ribosomes

    • Separate bound and unbound fractions by centrifugation

    • Analyze binding by SDS-PAGE and Western blotting

    • Determine binding affinity through titration experiments

  • Ribosome concentration dependence assay:

    • Perform in vitro translation with fixed YqjD concentration and varying ribosome concentrations

    • Plot protein synthesis versus ribosome concentration

    • Determine the stoichiometry of YqjD-mediated ribosome inactivation

    • Typical results show that at 30 nM YqjD, protein synthesis is strongly inhibited up to approximately 10 nM ribosomes but gradually increases at higher ribosome concentrations

  • Cross-linking and mass spectrometry:

    • Incorporate UV-sensitive amino acid analogs (pBpa) at specific positions in YqjD

    • Mix with ribosomes and UV-irradiate

    • Analyze cross-linked products by mass spectrometry

    • Identify specific ribosomal proteins contacted by YqjD

These assays have revealed that YqjD inhibits protein synthesis in a concentration-dependent manner, with full inhibition achieved at relatively low concentrations. The inhibition is specific to YqjD, as control proteins like YchF and SecA do not inhibit protein synthesis under the same conditions .

What is the physiological relevance of YqjD-mediated ribosome hibernation in E. coli?

YqjD-mediated ribosome hibernation appears to be a stress response mechanism that helps E. coli adapt to nutrient limitation and other stressful conditions during stationary phase. The physiological relevance includes:

  • Energy conservation: By inactivating translation, which is one of the most energy-intensive cellular processes, YqjD helps conserve energy during nutrient limitation .

  • Ribosome preservation: Hibernating ribosomes are protected from degradation, allowing for rapid resumption of protein synthesis when conditions improve.

  • Stationary phase adaptation: YqjD expression is regulated by RpoS, the master regulator of stationary phase and stress responses, indicating its role in this critical adaptive phase .

  • Membrane localization of ribosomes: YqjD may tether ribosomes to the membrane during stationary phase, potentially creating specialized translation microenvironments .

  • Growth control: Overexpression of YqjD inhibits cell growth, suggesting it can modulate growth rate in response to environmental conditions .

The presence of three paralogs (YqjD, ElaB, and YgaM) with similar functions suggests redundancy or specialization for different stress conditions. Their conservation across proteobacteria further supports their physiological importance .

How does YqjD compare to other known ribosome hibernation factors in bacteria?

YqjD represents a distinct class of ribosome hibernation factors compared to previously characterized factors:

Hibernation FactorOrganismMechanismLocalizationInduction
YqjD/ElaB/YgaME. coli, proteobacteriaBlocks ribosomal tunnel, binds 50S subunitMembrane-anchoredStationary phase, RpoS-dependent
RMF (Ribosome Modulation Factor)E. coli, many bacteriaBinds 30S subunit, promotes 70S dimerization to 100SCytoplasmicStationary phase
HPF (Hibernation Promoting Factor)Many bacteriaBinds mRNA channel of 30S subunitCytoplasmicStationary phase
YfiA (Ribosome Associated Inhibitor A)E. coliBlocks mRNA and tRNA binding sitesCytoplasmicCold shock

Key differences of YqjD include:

  • Membrane anchoring through its C-terminal domain, unlike most other hibernation factors

  • Interaction with the 50S subunit rather than the 30S subunit

  • Mechanism involving blockage of the ribosomal tunnel, similar to antimicrobial peptides

  • Formation of dimers that may simultaneously contact multiple sites on the ribosome

The YqjD mechanism resembles that of some eukaryotic dormancy factors and antimicrobial peptides that target the ribosomal peptide tunnel, suggesting convergent evolution of hibernation strategies .

What are the most promising future research directions for understanding YqjD function?

Several promising research directions would advance our understanding of YqjD function:

  • Structural studies:

    • Cryo-electron microscopy of YqjD-ribosome complexes to visualize binding mode

    • Structural analysis of YqjD dimers to understand the role of the conserved proline and transmembrane domain

    • Comparison of YqjD, ElaB, and YgaM structures to identify functional differences

  • In vivo dynamics:

    • Real-time imaging of YqjD-ribosome interactions during transition to stationary phase

    • Investigation of membrane microdomain formation and ribosome clustering

    • Temporal dynamics of YqjD, ElaB, and YgaM expression under various stress conditions

  • Reactivation mechanisms:

    • Identification of factors that reactivate YqjD-hibernated ribosomes

    • Kinetics of ribosome reactivation during recovery from stationary phase

    • Potential regulatory post-translational modifications of YqjD

  • Physiological roles:

    • Construction of triple deletion mutants (ΔyqjDΔelaBΔygaM) to assess phenotypes

    • Competitive fitness assays under various stress conditions

    • Metabolomic analysis to understand the impact on cellular physiology

  • Evolutionary aspects:

    • Comparative analysis of YqjD homologs across diverse bacterial species

    • Investigation of horizontal gene transfer patterns

    • Functional characterization of YqjD-like proteins in non-proteobacterial species

  • Therapeutic applications:

    • Exploration of YqjD-inspired peptides as potential antimicrobial agents

    • Investigation of YqjD as a target for antibiotics that prevent stress adaptation

These research directions would provide a more comprehensive understanding of this recently characterized class of ribosome hibernation factors and potentially lead to applications in biotechnology and medicine.

What are the key technical challenges in studying YqjD and how can they be overcome?

Studying YqjD presents several technical challenges that researchers should be aware of:

  • Membrane protein purification challenges:

    • Solution: Use mild detergents like DDM for extraction; consider nanodiscs or amphipols for maintaining native-like environment

    • Validate proper folding using circular dichroism or limited proteolysis

  • Growth inhibition upon overexpression:

    • Solution: Use tightly regulated expression systems like pBAD; consider low-copy plasmids; optimize induction conditions (lower temperature, reduced inducer concentration)

  • Distinguishing effects of paralogous proteins:

    • Solution: Create single, double, and triple knockout strains; perform complementation experiments; use specific antibodies for detection

  • Capturing transient ribosome interactions:

    • Solution: Employ site-specific cross-linking approaches; use real-time fluorescence techniques; consider proximity labeling methods

  • Separating ribosome binding from inactivation effects:

    • Solution: Develop separate assays for binding (pull-down, co-sedimentation) and activity (in vitro translation); create and test separation-of-function mutants

  • Visualizing membrane-ribosome complexes:

    • Solution: Use cryo-electron tomography of bacterial cells; employ super-resolution microscopy with specific labels

By addressing these challenges with appropriate experimental approaches, researchers can gain deeper insights into YqjD function and the mechanisms of ribosome hibernation.

How can researchers effectively design experiments to study the interplay between YqjD, ElaB, and YgaM?

To effectively study the interplay between the three paralogous proteins, researchers should consider:

  • Genetic approaches:

    • Generate single, double, and triple knockout strains

    • Create strains with controlled expression levels of each protein

    • Design complementation experiments with chimeric proteins

  • Expression analysis:

    • Monitor temporal expression patterns using reporter fusions

    • Perform ribosome profiling to identify translational regulation

    • Use quantitative proteomics to measure absolute protein levels under various conditions

  • Protein-protein interaction studies:

    • Investigate potential hetero-oligomerization using co-immunoprecipitation

    • Apply proximity labeling techniques (BioID, APEX) to map interaction networks

    • Use fluorescence resonance energy transfer (FRET) to detect direct interactions

  • Comparative functional analysis:

    • Test ribosome inactivation potency in standardized in vitro translation assays

    • Analyze ribosome binding specificities using structural and biochemical approaches

    • Compare effects on growth and stress resistance in various genetic backgrounds

  • Condition-specific roles:

    • Examine differential expression and activity under various stress conditions

    • Test competitive fitness of various mutant combinations

    • Analyze metabolic consequences using metabolomics

A systematic approach combining these strategies would help elucidate whether these proteins have redundant functions, act synergistically, or have specialized roles under different conditions or growth phases.

What is the current consensus on YqjD's role in bacterial physiology, and what major questions remain unanswered?

Current consensus on YqjD's role:

  • YqjD functions as a ribosome hibernation factor that inactivates translation during stationary phase

  • It is membrane-anchored and tethers ribosomes to the inner membrane

  • YqjD acts by binding to the 50S ribosomal subunit near the peptide tunnel exit

  • Its expression is regulated by the stationary phase sigma factor RpoS

  • YqjD forms dimers that are important for its function in ribosome inactivation

  • It represents a widespread class of hibernation factors conserved across proteobacteria

Major unanswered questions:

  • Reactivation mechanism: How are YqjD-hibernated ribosomes reactivated when conditions improve?

  • Functional specialization: What are the specific roles of YqjD versus its paralogs ElaB and YgaM? Do they respond to different stress conditions?

  • Regulatory network: What additional factors regulate YqjD expression and activity beyond RpoS and CsrA?

  • Subcellular organization: Does YqjD create specialized translation microenvironments at the membrane? Are these associated with specific membrane domains?

  • Molecular mechanism: What is the precise structural basis for ribosome inactivation? Does YqjD induce conformational changes in the ribosome?

  • Physiological advantage: What selective advantage does membrane-localized ribosome hibernation provide compared to cytoplasmic hibernation factors?

  • Interplay with other systems: How does YqjD-mediated hibernation coordinate with other stress response systems?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.