Recombinant Escherichia coli Uncharacterized protein yuaM (yuaM)

Shipped with Ice Packs
In Stock

Description

Introduction to YuaM

Recombinant Escherichia coli Uncharacterized Protein YuaM (yuaM) is a hypothetical protein encoded by the yuaM gene (synonym: ycaA) in E. coli K-12. Despite its designation as "uncharacterized," recent advances in recombinant protein technology have enabled its production and preliminary biochemical profiling. YuaM is expressed as a 231-amino-acid polypeptide (UniProt ID: Q9JMS7) with a molecular weight of approximately 26 kDa . Its functional role remains unknown, but homology-based analyses suggest potential involvement in cellular processes common to uncharacterized bacterial proteins, such as stress response or structural maintenance .

Recombinant Expression Systems

YuaM is typically expressed in E. coli using plasmid vectors with N-terminal affinity tags (e.g., His, GST, or FLAG) to facilitate purification . Key parameters for its production include:

Table 1: Expression and Purification Workflow

ParameterDetailSource
Host StrainE. coli BL21(DE3) or derivatives
VectorpET-based or pSF-p15A systems
InductionIPTG or rhamnose-dependent promoters
SolubilityImproved via low-copy plasmids (p15A origin)
Yield~1–10 mg/L culture (estimated)
PurificationImmobilized metal affinity chromatography

Notably, YuaM’s solubility is enhanced by low basal expression levels, aligning with strategies used for other challenging E. coli proteins .

Challenges and Optimization

  • Inclusion Body Formation: Like many recombinant proteins, YuaM tends to aggregate when overexpressed. Mitigation strategies include:

    • Lowering induction temperatures (16–25°C) .

    • Using solubility-enhancing tags (e.g., GST) .

    • Co-expressing molecular chaperones .

  • Transcriptional Regulation: Codon optimization at positions 3–5 (e.g., AAD UAU motifs) improves translational efficiency, as demonstrated for other E. coli proteins .

Potential Applications and Future Directions

While YuaM’s biological function is unconfirmed, its recombinant form serves as a tool for:

  • Antibody Production: As an immunogen for raising antibodies against uncharacterized bacterial proteins .

  • Structural Studies: Preliminary crystallization trials could resolve its 3D architecture .

  • Functional Screens: High-throughput assays (e.g., DNA-binding or stress-response tests) may elucidate its role .

Research Gaps and Opportunities

  • Functional Annotation: No in vivo or in vitro activity data exist for YuaM. Priority studies include:

    • Knockout phenotype analysis under stress conditions .

    • Screening for enzymatic activity (e.g., nuclease, ligase) .

  • Interactomics: Identification of binding partners via pull-down assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is desired, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
yuaM; ycaA; ECOK12F024; Uncharacterized protein YuaM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yuaM
Target Protein Sequence
MMYRVNHIMRTINEMSSYTPHMKVNRIAERLSKVQKISFCISVISFFLLAIITLTYGPFN TKSNLSFISALSLYFINVIMGVTYLSVPVINTIKYIYNFKGEVVNELIYDIDSDEQHIEA LLPYSLEELTYVSNCIQVRIPKIKSKCFLWGGGKTAIISILCLSYSAICIVNGGSIDGIF VGETGDKIIVAIMFFILYTSLMNMFFKQKLLYLQNLKMIIDMTIKIKRNFT
Uniprot No.

Target Background

Protein Families
FliR/MopE/SpaR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing uncharacterized proteins like yuaM in E. coli?

When selecting an expression system for an uncharacterized protein like yuaM, several factors must be considered. The search results indicate that medium to low copy number vectors often yield better protein production than high copy number vectors. Specifically, vectors containing the p15A origin of replication demonstrated higher expression levels of reporter proteins compared to high copy number vectors . This is likely due to the metabolic burden associated with high copy plasmids that can trigger decreased production of the target protein.

For promoter selection, you should consider:

  • T7 promoter: Provides strong expression but may lead to inclusion bodies

  • lac/trc/tac promoters: Offer moderate expression with better control

  • BAD promoter: Shows weaker strength but potentially higher soluble fraction

Research has shown that combining a high copy number origin of replication with a strong promoter often causes a metabolic mismatch, resulting in decreased protein production . Therefore, for an uncharacterized protein like yuaM where optimal expression conditions are unknown, starting with a p15A origin and moderately strong promoter (trc or tac) may provide a good balance between expression level and protein solubility.

How do carbon sources affect the expression of recombinant proteins in E. coli?

The choice of carbon source significantly impacts recombinant protein expression. Experimental data demonstrates that E. coli cultures grown with glycerol as a carbon source showed higher expression of the reporter protein YFP compared to glucose-supplemented cultures . For instance, E. coli wild-type transformed with pSF-p15A-trc-YFP growing with glycerol achieved maximum expression, serving as the 100% reference point for comparison with other conditions.

This difference in expression levels can be attributed to several factors:

  • Glycerol metabolism results in less acetate accumulation than glucose

  • Carbon catabolite repression is less pronounced with glycerol

  • Metabolic flux distribution differs between glycerol and glucose cultures

When designing expression experiments for an uncharacterized protein like yuaM, it would be advisable to test both carbon sources, as the optimal choice may depend on the specific protein characteristics and the expression system being used.

What should be considered when designing primers for cloning an uncharacterized protein gene like yuaM?

When designing primers for cloning yuaM into an expression vector, consider the following methodological approaches:

  • Codon optimization: Analyze the codon usage of yuaM and optimize it for E. coli expression if necessary.

  • Restriction sites: Include appropriate restriction enzyme sites that are absent in the yuaM sequence but present in the multiple cloning site of your target vector.

  • Fusion tags: Consider adding sequences for affinity tags (His6, GST, MBP) that will facilitate purification and potentially enhance solubility.

  • Protease cleavage sites: Include sequences for precision protease cleavage sites between the tag and yuaM to allow tag removal after purification.

  • Amber suppression sites: If planning to incorporate unnatural amino acids, design primers to introduce TAG codons at positions of interest .

Primer design should also account for parameters such as GC content (40-60%), melting temperature (Tm between 55-65°C), and avoiding secondary structures that might interfere with PCR efficiency.

How can the solubility of recombinant yuaM be optimized to reduce inclusion body formation?

Inclusion body formation is a common challenge when expressing recombinant proteins in E. coli. The solubility profile depends significantly on the expression system used. Research shows that promoter choice affects the soluble/insoluble fraction distribution of expressed proteins. For instance, when YFP was expressed under the control of the BAD promoter, a lower insoluble fraction was observed compared to other promoters .

To optimize solubility of yuaM, consider these methodological approaches:

  • Promoter selection: Use moderately strong or inducible promoters like BAD that allow slower, more controlled expression.

  • Temperature modulation: Lower the growth temperature to 18-25°C after induction to slow protein synthesis and facilitate proper folding.

  • Co-expression strategies: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist protein folding.

  • Fusion partners: Express yuaM as a fusion with solubility-enhancing tags such as MBP, SUMO, or Thioredoxin.

  • Induction optimization: Test various inducer concentrations and induction timing to find conditions that maximize soluble expression.

The relationship between expression conditions and protein solubility should be experimentally determined for yuaM, as the optimal conditions vary between proteins. When testing different conditions, analyze both soluble and insoluble fractions via SDS-PAGE and densitometric analysis to quantify the proportion of soluble protein, as was done in the referenced study .

What strategies can be employed to incorporate unnatural amino acids into yuaM for structural and functional studies?

Unnatural amino acid (UAA) incorporation offers powerful tools for studying the structure and function of uncharacterized proteins like yuaM. The amber codon suppression method enables site-specific incorporation of UAAs into proteins in E. coli expression systems.

The methodology requires:

  • An orthogonal tRNA/aminoacyl-tRNA synthetase (aaRS) pair that can incorporate the UAA at amber (UAG) stop codons .

  • Modification of the yuaM gene to include amber codons at positions of interest.

  • Expression in the presence of the UAA and the orthogonal tRNA/aaRS pair.

The most common orthogonal tRNA/aaRS pair used is derived from Methanococcus jannaschii, which normally encodes tyrosine but can be evolved to recognize various UAAs . This system works well in E. coli because:

  • The aaRS has minimal interaction with the anticodon of its tRNA

  • There is a lack of editing mechanism capable of deacylating the UAA

  • High expression levels can be achieved

For optimal efficiency, consider using:

  • The pEVOL plasmid system, which utilizes both constitutive and inducible promoters for the synthetase

  • E. coli strains with RF1 knockout, which reduces competition between translation termination and UAA incorporation

  • Evolved ribosomes that enhance amber suppression efficiency

Incorporating UAAs into yuaM could enable various structural and functional studies, including:

  • Site-specific fluorescent labeling for localization studies

  • Photo-crosslinking to identify interaction partners

  • Click chemistry for bioorthogonal modifications

  • Introducing biophysical probes for structural analysis

How does the metabolic burden affect recombinant protein production, and how can it be minimized?

Metabolic burden is a significant challenge in recombinant protein expression that can lead to decreased productivity. This burden arises from:

  • The presence of plasmids requiring replication and maintenance

  • Expression of antibiotic resistance genes

  • Transcription and translation of recombinant genes

  • Potential toxicity of the expressed protein

Research has shown that the combination of a high copy number origin of replication and a strong promoter causes metabolic burden that triggers decreased protein production . The effects include:

  • Altered growth rate

  • Differential expression of essential metabolic enzymes

  • Decreased target protein yield

  • Increased formation of inclusion bodies

To minimize metabolic burden when expressing yuaM, consider these approaches:

  • Use medium or low copy number plasmids rather than high copy vectors

  • Select moderate strength promoters or precisely controlled inducible systems

  • Optimize codon usage to match E. coli tRNA availability

  • Balance protein expression with cell growth by fine-tuning induction conditions

  • Consider using E. coli strains with enhanced metabolic capacity

Experimental data shown in the table below illustrates how plasmid copy number and promoter strength affect protein expression:

Expression SystemRelative Copy NumberPromoter StrengthYFP Expression (%)YFP Concentration (mg/L)
pSF-p15A-trc-YFPMedium (p15A origin)Strong (trc)100%~45-50
pSF-p15A-tac-YFPMedium (p15A origin)Medium (tac)~85%~40-45
pSF-pUC-BAD-YFPHigh (pUC origin)Weak (BAD)~50%~20-25
pSF-pUC-trc-YFPHigh (pUC origin)Strong (trc)~40%~15-20

Note: The values in this table are approximated from Figure 4 in the referenced study .

What analytical methods are most appropriate for characterizing an uncharacterized protein like yuaM?

Characterizing an uncharacterized protein requires a comprehensive analytical approach. For yuaM, consider employing these methodological strategies:

  • Structural Characterization:

    • Circular Dichroism (CD) spectroscopy to determine secondary structure content

    • X-ray crystallography or NMR for high-resolution structural determination

    • Cryo-electron microscopy for larger assemblies

    • Limited proteolysis to identify stable domains or flexible regions

  • Functional Characterization:

    • Enzymatic activity assays based on predicted function or structural homology

    • Binding assays to identify interaction partners

    • Isothermal titration calorimetry (ITC) for quantitative binding measurements

    • Thermal shift assays to assess stability and ligand binding

  • Localization and Interaction Studies:

    • Incorporation of unnatural amino acids for site-specific labeling

    • Pull-down assays to identify protein-protein interactions

    • Crosslinking studies to capture transient interactions

    • In vivo localization studies using fluorescently tagged variants

  • Advanced Characterization:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamics

    • Chemical crosslinking coupled with mass spectrometry (XL-MS) for structural constraints

    • Native mass spectrometry for oligomeric state determination

    • Single-molecule FRET to study conformational changes

For a truly uncharacterized protein like yuaM, it's advisable to begin with bioinformatic analyses to predict potential functions and guide experimental design, followed by a systematic application of these analytical methods.

How should expression experiments be designed to optimize recombinant yuaM production?

Designing robust expression experiments for yuaM requires systematic testing of multiple variables. A methodological approach should include:

  • Factorial experimental design testing:

    • Expression vectors with different origins of replication (p15A, pUC)

    • Promoters of varying strength (T7, trc, tac, BAD)

    • E. coli strains (wild-type vs. engineered strains like ΔackA mutant)

    • Carbon sources (glucose vs. glycerol)

    • Induction conditions (inducer concentration, timing, temperature)

  • Replicate design:

    • Perform experiments in at least triplicate to ensure statistical validity

    • Include appropriate controls for each experimental condition

    • Apply statistical testing (e.g., two-way ANOVA) to evaluate significant differences

  • Quantification methods:

    • Measure both total and soluble protein amounts

    • Use appropriate analytical techniques (SDS-PAGE, Western blot, fluorescence)

    • Determine protein concentration in standardized units (mg/L of culture)

  • Time-course analysis:

    • Monitor expression at multiple time points post-induction

    • Track growth parameters simultaneously with protein expression

    • Assess protein stability over time

The experimental approach used in the referenced study provides a good template, where YFP expression was evaluated under multiple conditions in a multiwell plate format, allowing direct comparison between conditions . Expression levels were quantified both as percentage relative to maximum expression and as absolute concentration (mg/L).

What considerations are important when designing a purification strategy for an uncharacterized protein like yuaM?

Developing a purification strategy for an uncharacterized protein requires careful consideration of several factors:

  • Initial planning:

    • Incorporate affinity tags (His6, GST, MBP) to facilitate purification

    • Consider tag position (N- or C-terminal) based on predicted protein topology

    • Include protease cleavage sites if tag removal is necessary

  • Solubility assessment:

    • Analyze the soluble/insoluble distribution of expressed protein

    • Develop separate strategies for soluble extraction versus inclusion body refolding

    • For inclusion bodies, test various solubilization and refolding conditions

  • Purification scheme development:

    • Begin with affinity chromatography based on the incorporated tag

    • Follow with ion exchange chromatography based on theoretical pI

    • Include size exclusion chromatography as a polishing step

    • Consider hydrophobic interaction chromatography if appropriate

  • Buffer optimization:

    • Test multiple buffer systems to identify optimal pH and ionic strength

    • Screen stabilizing additives (glycerol, reducing agents, specific ions)

    • Assess protein stability under various storage conditions

  • Quality control:

    • Verify purity by SDS-PAGE and mass spectrometry

    • Confirm proper folding using circular dichroism or fluorescence spectroscopy

    • Assess oligomeric state by size exclusion chromatography or native PAGE

For yuaM specifically, begin by analyzing its theoretical properties (molecular weight, pI, hydrophobicity) using bioinformatics tools to guide initial purification strategy decisions.

How can inclusion body formation be addressed when expressing yuaM in E. coli?

Inclusion body formation is a common challenge when expressing recombinant proteins. Data shows that even under optimized conditions, a significant percentage of recombinant protein may form insoluble aggregates . To address this issue with yuaM expression, consider these methodological approaches:

  • Prevention strategies:

    • Use weaker promoters like BAD, which have shown lower insoluble fraction formation

    • Lower growth temperature post-induction (18-25°C)

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use fusion partners known to enhance solubility (MBP, SUMO, Thioredoxin)

    • Reduce inducer concentration for slower protein synthesis

  • Solubilization and refolding:

    • Isolate inclusion bodies via differential centrifugation

    • Solubilize using strong denaturants (8M urea or 6M guanidine hydrochloride)

    • Refold by gradual dilution, dialysis, or on-column refolding techniques

    • Include additives that promote correct folding (L-arginine, sucrose, low concentrations of detergents)

  • Analysis and optimization:

    • Quantify soluble/insoluble ratios via SDS-PAGE and densitometry

    • Verify protein folding after refolding using activity assays or spectroscopic methods

    • Iteratively optimize solubilization and refolding conditions

Research has demonstrated that the choice of expression system significantly affects the soluble/insoluble protein ratio, with some conditions yielding nearly equal amounts of soluble and insoluble protein . Therefore, systematic testing of expression conditions is essential for maximizing soluble yuaM production.

What strategies can overcome limitations in unnatural amino acid incorporation efficiency?

When incorporating unnatural amino acids (UAAs) into recombinant yuaM, several challenges may limit efficiency. To overcome these limitations, consider these methodological approaches:

  • Enhancing suppression efficiency:

    • Use E. coli strains with RF1 knockout to reduce competition between translation termination and UAA incorporation

    • Employ evolved ribosomes that enhance amber suppression efficiency

    • Utilize the pEVOL plasmid system with both constitutive and inducible promoters for tRNA synthetase expression

  • Optimizing amber codon context:

    • The nucleotides surrounding the amber codon affect suppression efficiency

    • Avoid placing amber codons near the N-terminus (first 15 residues)

    • Avoid consecutive amber codons or multiple amber codons within close proximity

  • Selection of appropriate orthogonal tRNA/aaRS pair:

    • The Methanococcus jannaschii tyrosyl-tRNA synthetase/tRNA pair is well-established for E. coli

    • Consider evolved variants with high specificity for your UAA of interest

    • The crystal structure of evolved M. jannaschii tyrosyl-RS provides insights for rational design of mutations for specific UAAs

  • Screening strategies:

    • Implement dual positive/negative selection systems to identify optimal tRNA/aaRS variants

    • Use reporter systems (like fluorescent proteins with amber codons) to rapidly assess suppression efficiency

    • Apply molecular modeling and docking to design optimal mutations for a given UAA

Combined approaches that integrate genetic code expansion with E. coli-based screening formats show promise for developing proteins with novel properties . This approach could be particularly valuable for studying uncharacterized proteins like yuaM.

How might computational approaches complement experimental methods in characterizing yuaM?

Computational approaches can significantly enhance experimental characterization of uncharacterized proteins like yuaM:

  • Structure prediction:

    • AlphaFold2 and RoseTTAFold can predict protein structures with impressive accuracy

    • Molecular dynamics simulations can explore conformational dynamics

    • Homology modeling can leverage known structures of related proteins

    • Fragment-based methods can identify potential functional motifs

  • Function prediction:

    • Gene neighborhood analysis to identify functional associations

    • Protein-protein interaction network predictions

    • Ligand binding site prediction and virtual screening

    • Molecular docking to predict protein-ligand interactions

  • Design of targeted experiments:

    • Identifying optimal sites for unnatural amino acid incorporation

    • Guiding mutagenesis studies to probe structure-function relationships

    • Designing optimized constructs to enhance expression and solubility

    • Identifying potential post-translational modifications

  • Data integration:

    • Machine learning approaches to integrate multiple experimental datasets

    • Systems biology frameworks to place yuaM in biological context

    • Evolutionary analysis to identify conserved features

These computational approaches should be iteratively combined with experimental methods to progressively refine our understanding of yuaM's structure and function.

How can advanced genetic strategies improve recombinant yuaM expression and characterization?

Advanced genetic strategies offer promising approaches for improving both expression and characterization of uncharacterized proteins like yuaM:

  • Genome engineering approaches:

    • CRISPR-Cas9 systems for precise E. coli host modifications

    • Deletion of competing metabolic pathways to enhance protein production

    • Engineering strains with enhanced tRNA pools matching yuaM codon usage

    • Knockout of proteases that might degrade recombinant yuaM

  • Expanded genetic code applications:

    • Multiple unnatural amino acid incorporation using different suppression systems

    • Four-base codon suppression for additional coding capacity

    • Development of orthogonal ribosomes for dedicated translation of yuaM

    • Synthetic regulation systems for precise expression control

  • High-throughput screening platforms:

    • Display technologies (phage, yeast, bacterial) for variant screening

    • Microfluidic systems for single-cell analysis

    • Automated parallel expression optimization

    • Combining UAA incorporation with E. coli-based screening formats

  • Synthetic biology strategies:

    • Design of synthetic expression modules with minimal cross-talk

    • Cell-free expression systems for rapid prototyping

    • Minimal cell approaches to reduce background metabolism

    • Compartmentalization strategies to isolate expression machinery

The combination of amber codon suppression and four-base codon suppression techniques, alongside evolved ribosomes, represents a particularly promising direction for discovering novel properties of uncharacterized proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.